DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and FGD1

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_004454.2 Gene:FGD1 / 2245 HGNCID:3663 Length:961 Species:Homo sapiens


Alignment Length:374 Identity:97/374 - (25%)
Similarity:164/374 - (43%) Gaps:71/374 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EIISSEKSYLEQLELLMNFFVRPLKEQAIIDCSNHTL--------LFGQIEMIHNLNGEF-LREL 132
            |::.:||:|:.:|.||...|...|.|:|    .|.:.        :|..|..|:..:.:| |.||
Human   380 ELLQTEKAYVSRLHLLDQVFCARLLEEA----RNRSSFPADVVHGIFSNICSIYCFHQQFLLPEL 440

  Fly   133 EANME------NVAHAFLKMAPFFKLYSVYAFDYRGALFIIQDLISKNPVFRKFLEQTESRPEVQ 191
            |..||      .:.....|:|||.|:|..|..::..|:.::.....::..|:..:.      |||
Human   441 EKRMEEWDRYPRIGDILQKLAPFLKMYGEYVKNFDRAVELVNTWTERSTQFKVIIH------EVQ 499

  Fly   192 RK-------LNSLMIVPIQRVPRYKLLLEQVLLYTSPADADYKLLKESVKEIEATASHINTCVEE 249
            ::       |...|:.|:||:|||:|||:..||.......|.|..::|::.|...|.|.|..:.:
Human   500 KEEACGNLTLQHHMLEPVQRIPRYELLLKDYLLKLPHGSPDSKDAQKSLELIATAAEHSNAAIRK 564

  Fly   250 QEITQYLIHLQNSLVNRTPNIVKPSRRVIKEGVLQKITHK-GTEIKRYCVLMSDIFMYC------ 307
            .|....|:.:. .|:....:||.|::.:||||.:.|::.| ||...||.:|.:|..:||      
Human   565 MERMHKLLKVY-ELLGGEEDIVSPTKELIKEGHILKLSAKNGTTQDRYLILFNDRLLYCVPRLRL 628

  Fly   308 --KMIKERAPNTVVENSLECCCIFPLKKCKVYEMLPGNFKLTCQSDGIIFGSGDVQLSRTWVGFI 370
              :....||...|  :.:|      ||:..... ||..|.::.:...:...:...:..:.||..|
Human   629 LGQKFSVRARIDV--DGME------LKESSNLN-LPRTFLVSGKQRSLELQARTEEEKKDWVQAI 684

  Fly   371 RDAIDLHVQCRKTLR------------------KDSSKR--TPIRKKDM 399
            ...:..|.|..:|.:                  .|..||  ||||:|::
Human   685 NSTLLKHEQTLETFKLLNSTNREDEDTPPNSPNVDLGKRAPTPIREKEV 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 53/188 (28%)
PH-like 269..>311 CDD:302622 17/50 (34%)
PH 277..374 CDD:278594 26/105 (25%)
FGD1NP_004454.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..353
SH3-binding. /evidence=ECO:0000255 171..187
RhoGEF 376..559 CDD:238091 53/188 (28%)
PH1_FGD1 591..698 CDD:275392 28/115 (24%)
PH 591..688 CDD:278594 26/105 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 702..726 3/23 (13%)
FYVE_FGD1_2_4 725..789 CDD:277280 5/9 (56%)
PH2_FGD1-4 815..920 CDD:270056
PH 823..921 CDD:278594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 925..961
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X316
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.