DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and FGD2

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_016865918.1 Gene:FGD2 / 221472 HGNCID:3664 Length:662 Species:Homo sapiens


Alignment Length:326 Identity:86/326 - (26%)
Similarity:161/326 - (49%) Gaps:47/326 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRQK-GYGNGFIHSPQTPLSFSRELRQVLQERNLLTAKSRRKVCSMLDSNNSSPIGSPNPDAGKR 67
            ||:| ..|......|:|   .||  |.:...:|.|::::.||.|..:..:.|   |:..|:    
Human    51 PREKTNVGEAVGSEPRT---VSR--RYLNSLKNKLSSEAWRKSCQPVTLSGS---GTQEPE---- 103

  Fly    68 LGFRRQAIQEIISSEKSYLEQLELLMNFFVRPLKEQA---------IIDCSNHTLLFGQIEMIHN 123
                ::.:||::.:|::|:.:|.||...|.:.|.:.|         ::     .::|..|..|:.
Human   104 ----KKIVQELLETEQAYVARLHLLDQVFFQELLKTARSSKAFPEDVV-----RVIFSNISSIYQ 159

  Fly   124 LNGE-FLRELEANMEN------VAHAFLKMAPFFKLYSVYAFDYRGALFIIQDLISKNPVFRKFL 181
            .:.: ||.||:..:::      :.....|:|||.|:||.|..::..|..::.....|:|:|::.|
Human   160 FHSQFFLPELQRRLDDWTANPRIGDVIQKLAPFLKMYSEYVKNFERAAELLATWTDKSPLFQEVL 224

  Fly   182 EQTE-SRPEVQRKLNSLMIVPIQRVPRYKLLLE---QVLLYTSPADADYKLLKESVKEIEATASH 242
            .:.: |.......|...|:.|:||:|||:|||:   |.|...:|..||   .::::..|.:.|.|
Human   225 TRIQSSEASGSLTLQHHMLEPVQRIPRYELLLKEYIQKLPAQAPDQAD---AQKALDMIFSAAQH 286

  Fly   243 INTCVEEQEITQYLIHLQNSLVNRTPNIVKPSRRVIKEGVLQKITHKGTE-IKRYCVLMSDIFMY 306
            .|..:.|.|..|.|..:...| ....:||.||..:::||.:.||:.:..: ::||..|.:::.:|
Human   287 SNAAITEMERLQDLWEVYQRL-GLEDDIVDPSNTLLREGPVLKISFRRNDPMERYLFLFNNMLLY 350

  Fly   307 C 307
            |
Human   351 C 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 50/189 (26%)
PH-like 269..>311 CDD:302622 13/40 (33%)
PH 277..374 CDD:278594 9/32 (28%)
FGD2XP_016865918.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7163
SonicParanoid 1 1.000 - - X316
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.