DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and SPATA13

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001273721.1 Gene:SPATA13 / 221178 HGNCID:23222 Length:1339 Species:Homo sapiens


Alignment Length:315 Identity:78/315 - (24%)
Similarity:138/315 - (43%) Gaps:50/315 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PLSFSRELRQVLQERNLLTAKSRRKVCSMLDSNNSSPIGSPNPDAGK--------RLGFRRQAIQ 76
            |.||.| || |.||             .:.::::|:|....:.:|.:        :...|...|:
Human   884 PASFVR-LR-VNQE-------------ELSENSSSTPSEEQDEEASQSRHRHCENKQQMRTNVIR 933

  Fly    77 EIISSEKSYLEQLELLMNFFVRPLKEQAIIDCSNHT---------LLFGQIEMIHNLNGEFLREL 132
            ||:.:|:.|::.|        |.:.|..|..|..||         .:||.||.|:....:||::|
Human   934 EIMDTERVYIKHL--------RDICEGYIRQCRKHTGMFTVAQLATIFGNIEDIYKFQRKFLKDL 990

  Fly   133 -------EANMENVAHAFLKMAPFFKLYSVYAFDYRGALFIIQDLISKNPVFRKFLEQTESRPE- 189
                   |.::..:...||:....|.:||.|..::.||...:.:|: |...:|.|.|......: 
Human   991 EKQYNKEEPHLSEIGSCFLQNQEGFAIYSEYCNNHPGACLELANLM-KQGKYRHFFEACRLLQQM 1054

  Fly   190 VQRKLNSLMIVPIQRVPRYKLLLEQVLLYTSPADADYKLLKESVKEIEATASHINTCVEEQEITQ 254
            :...::..::.|:|::.:|.|.|.::|.||:....||..:|.:.:.::..|..||....:.|...
Human  1055 IDIAIDGFLLTPVQKICKYPLQLAELLKYTTQEHGDYSNIKAAYEAMKNVACLINERKRKLESID 1119

  Fly   255 YLIHLQNSLVN-RTPNIVKPSRRVIKEGVLQKITHKGTEIKRYCVLMSDIFMYCK 308
            .:...|.|:|. ...:|:..|..:|..|.|.|||.:|...:|...|.....:.||
Human  1120 KIARWQVSIVGWEGLDILDRSSELIHSGELTKITKQGKSQQRTFFLFDHQLVSCK 1174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 46/186 (25%)
PH-like 269..>311 CDD:302622 13/40 (33%)
PH 277..374 CDD:278594 11/32 (34%)
SPATA13NP_001273721.1 SH3_ASEF 821..892 CDD:212906 6/9 (67%)
RhoGEF 931..1110 CDD:279015 47/187 (25%)
PH_Collybistin_ASEF 1115..1253 CDD:269931 17/60 (28%)
PH 1143..1242 CDD:278594 11/32 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.