DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and Arhgef5

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_038964580.1 Gene:Arhgef5 / 140898 RGDID:620718 Length:1589 Species:Rattus norvegicus


Alignment Length:388 Identity:98/388 - (25%)
Similarity:167/388 - (43%) Gaps:87/388 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 RQAIQEIISSEKSYLEQLELLMNFFVRPLKEQAIIDCSNHTLLFGQIEMIHNLNGEFLRELEANM 136
            ::|..|:|.||.|||..|.:.::.|....:.:|.:...:|..||.:::.:.:::..||.:||.|.
  Rat  1168 QEAKFELIVSEASYLRSLNIAVDHFQHSTQLRATLSNQDHQWLFSRLQDVRDVSTTFLSDLEENF 1232

  Fly   137 EN------VAHAFLKMAP-FFKLYSVYAFD--YRGALFIIQDLISKNPVFRKFLEQTESRPEVQR 192
            ||      |....|..|| |.::|..|..:  |:...|  |.|::.|..||:.||:.||.|..||
  Rat  1233 ENNIFSFQVCDVVLDHAPDFHRVYLPYVTNQTYQERTF--QSLMNSNSSFREVLEKLESDPVCQR 1295

  Fly   193 -KLNSLMIVPIQRVPRYKLLLEQVLLYTSPADADYKLLKESVKEIEATASH---------INTCV 247
             .|.|.:|:|.||:.|.||||:.:|..|.|.         |.:|.|||.:|         .|:.|
  Rat  1296 LSLKSFLILPFQRITRLKLLLQNILKRTQPG---------SSEEAEATKAHHALEKLIRDCNSNV 1351

  Fly   248 EEQEITQYLIHLQNSLVNRTP--NIVKPSRRVIKEGVL------------QKITHKGTEIKRY-- 296
            :....|:.||:|...:.....  .::..||.::|.|.|            :|:|.:...:..:  
  Rat  1352 QRMRRTEELIYLSQKIEFECKIFPLISQSRWLVKSGELTALEFSVSPGLKRKLTTRPVHLHLFND 1416

  Fly   297 CVLMS-----DIFMYCKMIKERAPNTVVENSLECCCIFPLKKCKVYEMLPGNFK------LTCQS 350
            |:|:|     ..|    ::.:.||.:.:..          :||::  .|.|..|      |...:
  Rat  1417 CLLLSRPREGSRF----LVFDHAPFSSIRG----------EKCEM--KLHGAHKNLFRLFLLHNA 1465

  Fly   351 DG----IIFGSGDVQLSRTWVGFI---RDAIDL-------HVQCRKTLRKDSSKRTPIRKKDM 399
            .|    .:|.:........|:..:   |:.:||       .|||.:..:...:....:.|.|:
  Rat  1466 QGTQAEFLFRTETQSEKLRWISALAMPREELDLLECYDSPQVQCLRAYKPRENDELALEKADV 1528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 62/188 (33%)
PH-like 269..>311 CDD:302622 11/60 (18%)
PH 277..374 CDD:278594 21/128 (16%)
Arhgef5XP_038964580.1 ARHGEF5_35 1..478 CDD:406010
PHA03247 <395..840 CDD:223021
RhoGEF 1172..1348 CDD:395496 61/186 (33%)
PH_ephexin 1370..1496 CDD:269929 23/141 (16%)
SH3_ARHGEF5_19 1506..1560 CDD:212873 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.