DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and Prex2

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_006495504.1 Gene:Prex2 / 109294 MGIID:1923385 Length:1617 Species:Mus musculus


Alignment Length:275 Identity:68/275 - (24%)
Similarity:125/275 - (45%) Gaps:25/275 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DAGKRLGFRRQAIQEIISSEKSYLEQLELLMNFFVRPLKEQAIIDCSNHT------LLFGQIEMI 121
            :..|:|..|...:.|:..:|:.|:..||.|::.|:..:.:.|......:.      :||..||.|
Mouse     8 EVDKQLRLRVCVLSELQKTERDYVGTLEFLVSAFLHRMNQCAAAKVDKNVTEETVKMLFSNIEEI 72

  Fly   122 HNLNGEFLRELE-------ANMENVAHAFLKMAPFFKLYSVYAFDYRGALFIIQDLISKNPVFRK 179
            ..::.|||:.:|       :..:.|...||.....|::|..|..::..|..::.:| :|....|.
Mouse    73 LIVHKEFLKVVEECLYPEPSAQQEVGACFLHFKDKFRIYDEYCSNHEKAQKLLLEL-NKIRTIRT 136

  Fly   180 FLEQ---TESRPEVQRKLNSLMIVPIQRVPRYKLLLEQVLLYTSPADADYKLLKESVKEIEATAS 241
            ||..   ...|......|...::.||||:.:|.|||:::|..|....:||..:.|:::.::|..|
Mouse   137 FLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLLLKELLKRTPRRHSDYTAVMEALQAMKAVCS 201

  Fly   242 HINTCVEEQE----ITQYLIHLQNSLVNRTPNIVKPSRRVIKEGVLQKITHKGTEIKRYCVLMSD 302
            :||....:.|    :.::..|::..   ...||......::..|||.||: .|...:|...|..:
Mouse   202 NINEAKRQMEKLEVLEEWQAHIEGW---EGSNITDTCTEMLMCGVLMKIS-SGNIQERVFFLFDN 262

  Fly   303 IFMYCKMIKERAPNT 317
            :.:|||....|..|:
Mouse   263 LLVYCKRKHRRLKNS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 46/185 (25%)
PH-like 269..>311 CDD:302622 13/41 (32%)
PH 277..374 CDD:278594 13/41 (32%)
Prex2XP_006495504.1 RhoGEF 19..204 CDD:366202 46/185 (25%)
PH_Collybistin_ASEF 210..356 CDD:269931 17/72 (24%)
DEP_1_P-Rex 374..454 CDD:239886
DEP_2_P-Rex 466..558 CDD:239887
PDZ_signaling 587..662 CDD:238492
PDZ_signaling 669..736 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.