DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and prex2

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_031759716.1 Gene:prex2 / 100490424 XenbaseID:XB-GENE-6048678 Length:1603 Species:Xenopus tropicalis


Alignment Length:276 Identity:71/276 - (25%)
Similarity:126/276 - (45%) Gaps:19/276 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GSPNPDAGKRLGFRRQAIQEIISSEKSYLEQLELLMN-FFVRPLKEQAIIDCSNHT-----LLFG 116
            |....|..:.|..|...:.|::.:|:.|:..||.|:: ||.|.::..|:....|.|     :||.
 Frog     8 GEHGKDLERHLRLRVCVLSELLKTERDYVGTLEFLVSAFFHRMMQYAALKADKNVTEETVKILFS 72

  Fly   117 QIEMIHNLNGEFLRELE-------ANMENVAHAFLKMAPFFKLYSVYAFDYRGALFIIQDLISKN 174
            .||.|..::.|||..:|       ..::.|.:.||:....|.:|..|..::..|..::.: |:|.
 Frog    73 NIEDILAVHKEFLSLIEDCLYPEPNALQEVGNCFLRFKERFAIYDEYCSNHEKAQKLLLE-INKI 136

  Fly   175 PVFRKFLEQ---TESRPEVQRKLNSLMIVPIQRVPRYKLLLEQVLLYTSPADADYKLLKESVKEI 236
            ...|.||..   ...|......|...::.||||:.:|.|||.::|..|....:||..:.::::.:
 Frog   137 RTVRTFLLNCMLLGGRKNTDVPLEGYLVAPIQRICKYPLLLRELLKRTPKKHSDYVCVVDALQAM 201

  Fly   237 EATASHINTCVEEQEITQYLIHLQNSLVN-RTPNIVKPSRRVIKEGVLQKITHKGTEIKRYCVLM 300
            :|..::||....:.|..:.|...|:.:.. ...:|......::..|||.||: .|....|...|.
 Frog   202 KAVCTNINEAKRQMEKLEVLEEWQSHIEGWEGSSITDTCTEMLMHGVLLKIS-SGNIQDRVFFLF 265

  Fly   301 SDIFMYCKMIKERAPN 316
            .::.:|||..:.|..|
 Frog   266 DNLLVYCKRKQRRLKN 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 48/185 (26%)
PH-like 269..>311 CDD:302622 12/41 (29%)
PH 277..374 CDD:278594 13/40 (33%)
prex2XP_031759716.1 RhoGEF 24..209 CDD:395496 48/185 (26%)
PH_Collybistin_ASEF 215..362 CDD:269931 17/68 (25%)
DEP 379..459 CDD:413322
DEP_2_P-Rex 471..563 CDD:239887
PDZ 672..740 CDD:214570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.