DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGEF4 and fgd4

DIOPT Version :9

Sequence 1:NP_648101.1 Gene:RhoGEF4 / 38806 FlyBaseID:FBgn0035761 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_031754365.1 Gene:fgd4 / 100038050 XenbaseID:XB-GENE-493422 Length:895 Species:Xenopus tropicalis


Alignment Length:495 Identity:123/495 - (24%)
Similarity:209/495 - (42%) Gaps:111/495 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SSPIGSPNPDAG-------KRLGFRRQAIQ-------EIISSEKSYLEQLELLMNFFVRPLKE-- 102
            |||.|....|.|       :...|:....|       |::.:|::|:.:||||..|....:||  
 Frog   308 SSPTGEALEDIGTINITIAEPTDFKETNEQKLHNIANELLETERAYVSRLELLQTFHDALMKEAK 372

  Fly   103 QAIIDCSNHTLLFGQIEMIHNLNGEF-LRELEANME------NVAHAFLKMAPFFKLYSVYAFDY 160
            |..........:|..|..|.:.:|:| |.|||:.|:      .:.....|:|||.|:|:.|..::
 Frog   373 QGSFPVEVLNKIFSNISSIQSFHGQFLLPELESRMKEWSISPKIGDILQKLAPFLKMYAEYVKNF 437

  Fly   161 RGALFIIQDLISKNPVFRKFLEQTESRPEVQRK-------LNSLMIVPIQRVPRYKLLLEQVLLY 218
            ..|:..::..:.|:..|:..:|      |:||:       |...|:.|:||:|||::||:. .|.
 Frog   438 DNAMETLRGWMEKSVQFKNVVE------EIQREGKCGNLTLQHHMLGPVQRIPRYEMLLKD-YLR 495

  Fly   219 TSPADA-DYKLLKESVKEIEATASHINTCVEEQEITQYLIHLQNSLVNRTPNIVKPSRRVIKEGV 282
            ..|||: |.|..:::::.|...|:|.||.:.:.|..:.|:.:. .::....:||.||..:||||.
 Frog   496 KLPADSLDRKDAEKALELISFAATHSNTAIRKMENLKKLLSIY-EMLGEEEDIVHPSNELIKEGQ 559

  Fly   283 LQKITHKGTEI-KRYCVLMSDIFMYCKMIKERAPN-TVVENSLECCCIFPLKKCKVYEM----LP 341
            :.|:..:.|.. :||..|::::.:||      .|. ::|...........|:..||.|.    .|
 Frog   560 ILKLAARNTSAQERYLFLLNNMLLYC------VPKFSLVGTKYTLRTKIGLEGMKVVETQNEDYP 618

  Fly   342 GNFKLTCQSDGIIFGSGDVQLSRTWVGFIRDAI--------DLHVQCRKTLRKDSSK-------- 390
            ..|:::.:...:...:...|....|:..:||.|        ...:...|.|.:..|:        
 Frog   619 HTFQISGKERTLELQASSEQNKEEWIKALRDTIAEVQQKNETFKIAIAKELEETPSEVSRAELGL 683

  Fly   391 RTP--IRKKDM-------KKFGA-----------DYVL----SPNKRKCEYDTVFRNK------- 424
            |.|  ||..::       ::|.|           .||:    |..|...|||:...||       
 Frog   684 RAPRWIRDNEVTMCMKCKEQFNALTRRRHHCRACGYVVCWKCSDYKATLEYDSNKMNKVCKDCYK 748

  Fly   425 --NRSTDSEEETEDSACFSRKRKVASGILRAPNGNPMGKA 462
              ..|.||||:       .:||    |||...:....|.:
 Frog   749 ILRGSIDSEEK-------EKKR----GILEIESAEVSGNS 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGEF4NP_648101.1 RhoGEF 74..244 CDD:279015 55/193 (28%)
PH-like 269..>311 CDD:302622 15/42 (36%)
PH 277..374 CDD:278594 23/102 (23%)
fgd4XP_031754365.1 PspC_subgroup_2 <85..349 CDD:411408 9/40 (23%)
RhoGEF 339..522 CDD:238091 54/189 (29%)
PH1_FDG4 554..647 CDD:275434 21/98 (21%)
FYVE_FGD1_2_4 686..750 CDD:277280 14/63 (22%)
PH2_FGD1-4 770..872 CDD:270056 1/8 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm49235
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X316
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.