DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RHOB and Mtl

DIOPT Version :10

Sequence 1:NP_004031.1 Gene:RHOB / 388 HGNCID:668 Length:196 Species:Homo sapiens
Sequence 2:NP_524533.1 Gene:Mtl / 43319 FlyBaseID:FBgn0039532 Length:195 Species:Drosophila melanogaster


Alignment Length:155 Identity:33/155 - (21%)
Similarity:50/155 - (32%) Gaps:71/155 - (45%)


- Green bases have known domain annotations that are detailed below.


Human   680 YLSAAATRAAPSGDPDRDPGGGGGGRRRPRPATRRPAVMTSSSMASGSGM------TSS------ 732
            ::.||....|.:.:||.|                 ..|::|.|:.:..|.      ||:      
  Fly     5 FVIAALAAVAVAQNPDAD-----------------AQVLSSDSVVNPDGSYQWNYETSNGIRAQE 52

Human   733 SGSGMTSSSGSSASAVLIETRRDYSTELSVTIAVGASLLFLNVLAFAALYYKKDKRRHETHRRPP 797
            .|.|..|:.||::     .|.|| .|.:|:|                   |..|:..::      
  Fly    53 QGVGGQSAQGSAS-----WTDRD-GTPISLT-------------------YVADENGYQ------ 86

Human   798 PPRPPQAPPSAAAADRNPRPDPGPA 822
                ||       .|..||..|.||
  Fly    87 ----PQ-------GDHLPREGPVPA 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RHOBNP_004031.1 RhoA_like 5..179 CDD:206662
Effector region. /evidence=ECO:0000255 34..42
MtlNP_524533.1 RHO 9..182 CDD:197554 32/151 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.