DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED4 and MED4

DIOPT Version :9

Sequence 1:NP_648094.1 Gene:MED4 / 38799 FlyBaseID:FBgn0035754 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_014817.3 Gene:MED4 / 854345 SGDID:S000005700 Length:284 Species:Saccharomyces cerevisiae


Alignment Length:232 Identity:50/232 - (21%)
Similarity:92/232 - (39%) Gaps:58/232 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AHQKISSTELV-------DLLDLLVAKDEEFRKMLELAEEQAKVEEAMDQLRAKVEVHDREIQKL 86
            :..|:|..:|.       |.|..||...:.|:..|::|::..:.:||:.:....:..:|...:.|
Yeast    33 SEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNL 97

  Fly    87 QKSLKDAELILSTAIFQARQKLASINQAN----------------------KRPVSSEELIKYAH 129
            ||..||:|.:.|    :.|:.|..:|:.:                      :..::|.||:.||.
Yeast    98 QKIDKDSEELDS----KTRKILEILNECHDELKALPMLEQVEFEKNTILQQRSKINSTELLDYAT 158

  Fly   130 RISSANAVSAPLTW---CIGDLRRPYPTDIEMRNGLL------GKSEQNINGGTV--THQNSGMP 183
            ::|....:  |.|:   .:|.....:|.:..:|.|:|      .|....|.|..|  |...:..|
Yeast   159 KLSKFTKI--PPTFDKGAVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPGEEVEETEVPTVPP 221

  Fly   184 S---EQQRTLSGSAGS---------GSGSGAGGEVPN 208
            |   ||:..::...|:         |:....|.|..|
Yeast   222 SQSEEQKGQMAKKEGTPKTDSFIFDGTAKEVGDEADN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED4NP_648094.1 Med4 47..189 CDD:287038 38/177 (21%)
MED4NP_014817.3 Med4 67..>208 CDD:401849 37/185 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13208
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.