DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED4 and AT5G02850

DIOPT Version :9

Sequence 1:NP_648094.1 Gene:MED4 / 38799 FlyBaseID:FBgn0035754 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_195905.1 Gene:AT5G02850 / 831762 AraportID:AT5G02850 Length:426 Species:Arabidopsis thaliana


Alignment Length:326 Identity:70/326 - (21%)
Similarity:107/326 - (32%) Gaps:122/326 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 STKERLLLLIDDIEMIAKELIEQAHQKISSTELVDLLDLLVAKDEEFRK-------MLELAEEQA 63
            ||||    ::.....:..:|.|      :.|||.::|||..||.:..|:       :|..|.:..
plant   140 STKE----ILSQFNSLQTQLFE------AVTELQEILDLQDAKQKVAREIKSKDSSLLAFANKLK 194

  Fly    64 KVEEAMDQL-----------RAKVEVHDREIQKLQKSLKDAELILSTAIFQARQKLASINQANKR 117
            ..|..:|.|           |:|:|..|.:        .|.|...|:....::.||         
plant   195 DAERVLDMLVDDYSDYRKPKRSKIEEDDED--------NDNESSSSSTTVSSQLKL--------- 242

  Fly   118 PVSSEELIKYAHRIS-------SANAVSAPLTWCIGDLRRPYPTDIEMRNGL----------LGK 165
                ::::.|||:||       ...|..|||...:    .|.|.|.:||...          |.|
plant   243 ----KDILAYAHKISYTTFAPPEFGAGQAPLRGAL----PPAPQDEQMRASQLYTFADLDIGLPK 299

  Fly   166 SEQNI----------------------------NGGTVTHQNSGMPSEQQRTLSGSAGSGSGSGA 202
            :.:|:                            |....:....|||.|..|.|....   .|...
plant   300 TVENMEKKVEALIEPPPPPEAMDISAIHNLLPPNIAVPSGWKPGMPVELPRDLPLPP---PGWKP 361

  Fly   203 GGEV----------PNAFQNQFNWNLGELHM--TMGASGNTVALETRAQDDVEVMSTDSSSSSSS 255
            |..|          |.|..:|        ||  :.|.......::.||. .::::..|.||..||
plant   362 GDPVVLPPLESIAAPRAEDHQ--------HMRPSQGLHRPPDVIQVRAV-QLDILEDDDSSDYSS 417

  Fly   256 D 256
            |
plant   418 D 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED4NP_648094.1 Med4 47..189 CDD:287038 39/204 (19%)
AT5G02850NP_195905.1 Med4 143..320 CDD:401849 43/211 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13208
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.