DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED4 and mmachc

DIOPT Version :9

Sequence 1:NP_648094.1 Gene:MED4 / 38799 FlyBaseID:FBgn0035754 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001108361.2 Gene:mmachc / 555267 ZFINID:ZDB-GENE-030131-3167 Length:250 Species:Danio rerio


Alignment Length:151 Identity:27/151 - (17%)
Similarity:54/151 - (35%) Gaps:42/151 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LAEEQAKVEEAMDQLRAKVEVHDREIQKLQKSLKD----------------AELILST-AIFQA- 104
            :|....:|||.:...|..::....||...:....:                |.|::|| |:|:. 
Zfish     1 MAISSERVEELLRTFRESLKAKGFEIYPFKVGWYNAVLTAAHHLQYPADTLAVLVISTPAMFECA 65

  Fly   105 ------RQKLASINQANKRPVSSEELIKYAHRISSANAVSAPLTWCIGDLRRPYPTDIEM----R 159
                  .|...|:    :.|:..          .:|:.:||.::.|..:.......|.||    :
Zfish    66 FLPFLQSQSCESL----RDPIDQ----------CTAHTLSACISLCFANQFVDVSYDYEMLPSRK 116

  Fly   160 NGLLGKSEQNINGGTVTHQNS 180
            ...|.::..:::|....:|.|
Zfish   117 PKFLAQTAAHVSGAAYYYQTS 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED4NP_648094.1 Med4 47..189 CDD:287038 27/151 (18%)
mmachcNP_001108361.2 MMACHC 23..239 CDD:293295 22/129 (17%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q9Y4U1 119..122 1/2 (50%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q9Y4U1 133..135 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4552
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.