DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED4 and med4

DIOPT Version :9

Sequence 1:NP_648094.1 Gene:MED4 / 38799 FlyBaseID:FBgn0035754 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_031751774.1 Gene:med4 / 496653 XenbaseID:XB-GENE-972352 Length:267 Species:Xenopus tropicalis


Alignment Length:263 Identity:114/263 - (43%)
Similarity:157/263 - (59%) Gaps:39/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFHLSTKERLLLLIDDIEMIAKELIEQAHQKISST-ELVDLLDLLVAKDEEFRKMLELAEEQAK 64
            :|.||...|.       |||:|.    ..:||:|.. |...:|:||:.||.||::::::|..|.|
 Frog    32 LSGHLKALEL-------IEMLAL----SRNQKLSQPGEENQILELLIQKDGEFQELMKVALSQGK 85

  Fly    65 VEEAMDQLRAKVEVHDREIQKLQKSLKDAELILSTAIFQARQKLASINQANKRPVSSEELIKYAH 129
            :.:.|..|..:||..|.:||:|||.||:||.||:||::||::||.||::|.|..:||||||||||
 Frog    86 IHQEMQVLEKEVEKRDSDIQQLQKQLKEAEHILATAVYQAKEKLKSIDKARKGAISSEELIKYAH 150

  Fly   130 RISSANAVSAPLTWCIGDLRRPYPTDIEMRNGLLGKSEQNINGGTVTHQNSGMPSEQQRTLSGSA 194
            |||::|||.|||||..||.|||||||:|||:||||             |.|.:|:      :|..
 Frog   151 RISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLG-------------QMSNLPT------NGVN 196

  Fly   195 GSGSGSG-AGGEVPNAFQNQFNWNLGELHMTM--GASGNTVALET-----RAQDDVEVMSTDSSS 251
            |...|.. |.|.:|:....|:.|...::.|.|  ....|...:|:     ..::|||||||||||
 Frog   197 GHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSNEFLMESLGPNKENEEDVEVMSTDSSS 261

  Fly   252 SSS 254
            |||
 Frog   262 SSS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED4NP_648094.1 Med4 47..189 CDD:287038 73/141 (52%)
med4XP_031751774.1 Med4 61..>188 CDD:401849 74/139 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 152 1.000 Domainoid score I4286
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8568
Inparanoid 1 1.050 197 1.000 Inparanoid score I3691
OMA 1 1.010 - - QHG46272
OrthoDB 1 1.010 - - D1333917at2759
OrthoFinder 1 1.000 - - FOG0006646
OrthoInspector 1 1.000 - - otm48218
Panther 1 1.100 - - LDO PTHR13208
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2637
SonicParanoid 1 1.000 - - X4874
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.