DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED4 and Mmachc

DIOPT Version :9

Sequence 1:NP_648094.1 Gene:MED4 / 38799 FlyBaseID:FBgn0035754 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001101432.1 Gene:Mmachc / 313520 RGDID:1310806 Length:279 Species:Rattus norvegicus


Alignment Length:46 Identity:12/46 - (26%)
Similarity:18/46 - (39%) Gaps:6/46 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VEEAMDQLRAKV----EVHDREIQKLQKSLKDAELILSTAIFQARQ 106
            |.|...:|..:|    |||.....|:  ..:.|..:...|.:..||
  Rat    90 VTEKFPELHIEVIADYEVHPNRRPKI--LAQTAAHVAGAAYYYQRQ 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED4NP_648094.1 Med4 47..189 CDD:287038 12/46 (26%)
MmachcNP_001101432.1 MMACHC 20..234 CDD:293295 12/46 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4552
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.