powered by:
Protein Alignment MED4 and Mmachc
DIOPT Version :9
Sequence 1: | NP_648094.1 |
Gene: | MED4 / 38799 |
FlyBaseID: | FBgn0035754 |
Length: | 258 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001101432.1 |
Gene: | Mmachc / 313520 |
RGDID: | 1310806 |
Length: | 279 |
Species: | Rattus norvegicus |
Alignment Length: | 46 |
Identity: | 12/46 - (26%) |
Similarity: | 18/46 - (39%) |
Gaps: | 6/46 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 65 VEEAMDQLRAKV----EVHDREIQKLQKSLKDAELILSTAIFQARQ 106
|.|...:|..:| |||.....|: ..:.|..:...|.:..||
Rat 90 VTEKFPELHIEVIADYEVHPNRRPKI--LAQTAAHVAGAAYYYQRQ 133
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
MED4 | NP_648094.1 |
Med4 |
47..189 |
CDD:287038 |
12/46 (26%) |
Mmachc | NP_001101432.1 |
MMACHC |
20..234 |
CDD:293295 |
12/46 (26%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4552 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.