DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED4 and MED4

DIOPT Version :9

Sequence 1:NP_648094.1 Gene:MED4 / 38799 FlyBaseID:FBgn0035754 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_054885.1 Gene:MED4 / 29079 HGNCID:17903 Length:270 Species:Homo sapiens


Alignment Length:261 Identity:113/261 - (43%)
Similarity:165/261 - (63%) Gaps:30/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 STKERLLLLIDDIEMIAKELIE----QAHQK-ISSTELVDLLDLLVAKDEEFRKMLELAEEQAKV 65
            ||:||||..::|:|::::||||    ..:|| :.:.|...:|:||:.:|.||:::::||..|.|:
Human    25 STRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKI 89

  Fly    66 EEAMDQLRAKVEVHDREIQKLQKSLKDAELILSTAIFQARQKLASINQANKRPVSSEELIKYAHR 130
            ...|..|..:||..|.:||:|||.||:||.||:||::||::||.||.:|.|..:||||:||||||
Human    90 HHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHR 154

  Fly   131 ISSANAVSAPLTWCIGDLRRPYPTDIEMRNGLLGKSEQNINGGTVTHQNSGMPSEQQRTLSGSAG 195
            ||::|||.|||||..||.|||||||:|||:||||:    :|..:....|..:|.:          
Human   155 ISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQ----MNNPSTNGVNGHLPGD---------- 205

  Fly   196 SGSGSGAGGEVPNAFQNQFNWNLGELHMTMGASGNT--VALE-----TRAQDDVEVMSTDSSSSS 253
                :.|.|.:|:....|:.|...::.|.|....::  ..||     ...:||||:|||||||||
Human   206 ----ALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSS 266

  Fly   254 S 254
            |
Human   267 S 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED4NP_648094.1 Med4 47..189 CDD:287038 72/141 (51%)
MED4NP_054885.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Med4 64..>189 CDD:401849 70/124 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..270 16/50 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142479
Domainoid 1 1.000 150 1.000 Domainoid score I4406
eggNOG 1 0.900 - - E1_KOG4552
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8568
Inparanoid 1 1.050 191 1.000 Inparanoid score I3885
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46272
OrthoDB 1 1.010 - - D1333917at2759
OrthoFinder 1 1.000 - - FOG0006646
OrthoInspector 1 1.000 - - oto89464
orthoMCL 1 0.900 - - OOG6_105627
Panther 1 1.100 - - LDO PTHR13208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4874
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.