DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED4 and pmc4

DIOPT Version :9

Sequence 1:NP_648094.1 Gene:MED4 / 38799 FlyBaseID:FBgn0035754 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_596462.1 Gene:pmc4 / 2539994 PomBaseID:SPBC1105.06 Length:239 Species:Schizosaccharomyces pombe


Alignment Length:162 Identity:28/162 - (17%)
Similarity:70/162 - (43%) Gaps:30/162 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IDDIEMIAKELIEQAHQKISSTELVDLLDLLVAKDEEFRKMLELAEEQAKVEEAMDQLRAKVEVH 79
            ||.||....:.:..:.:|:....|::....||.   ..:.:..|........|..:::.:.:: .
pombe     7 IDSIEECLNKQLRLSSEKVDQYVLIENWTSLVG---HLKTLHSLISNYTNGRELQNEISSLLK-Q 67

  Fly    80 DREIQ-KLQKSLKDAELILSTAIFQARQKLASINQANKRPVSSEELIKYAHRISSANA------- 136
            |:|:. ::|..:::...|..|.:.:      :::...::.|::|.|:.|..::|..::       
pombe    68 DKELDLQIQDCMREMTSIYDTHLPK------TVSGRKRQKVNAETLLDYGRKLSKFSSAPPGYNP 126

  Fly   137 -----VSAPLTWCIGDLRRPYPTDIEMRNGLL 163
                 ..||:.:       |:|::.:||..||
pombe   127 ETGQDAKAPVHY-------PWPSEDQMRKTLL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED4NP_648094.1 Med4 47..189 CDD:287038 20/130 (15%)
pmc4NP_596462.1 Med4 41..>153 CDD:287038 20/125 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13208
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.