DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc27 and CDC23

DIOPT Version :10

Sequence 1:NP_648093.2 Gene:Cdc27 / 38798 FlyBaseID:FBgn0012058 Length:900 Species:Drosophila melanogaster
Sequence 2:NP_004652.2 Gene:CDC23 / 8697 HGNCID:1724 Length:597 Species:Homo sapiens


Alignment Length:461 Identity:117/461 - (25%)
Similarity:194/461 - (42%) Gaps:106/461 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 SHHLSEKRKEKVETITSSG-ANNNSGGRSAAEEAKVLLNNSLNNAQTMAHQLMG----------- 530
            |.:||.::|:..||:.|.| .........|..|.:|.|:.     :..|.:|.|           
Human   121 SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSK-----KHQARELDGFGLYLYGVVLR 180

  Fly   531 ---LKKQSAD------GLMALLRG-----------------------------LAEAY---QLLS 554
               |.|::.|      .::.|..|                             ||..|   ||: 
Human   181 KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTELQLI- 244

  Fly   555 NFQCKAAIKQLETTIPKHHLNSSWVQSLIGLARYEMREYEAAVAIFETIHKTEPCRLDYMEIYSS 619
                :.|:::.:..|......||::.|.|.:|.:.:|:.:.|::||..:.|.:|.|::.|:.:|:
Human   245 ----EEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSN 305

  Fly   620 SLWHLQREVELSALAQDLINQDKTSPVTWCVSGNCFSLQKEHETAIKFFKRAVQVDPDFVYSYTL 684
            .|:....:.|||.||.:|...||....|.||.||.:||:.:||.|..:|:||::::|.::.::||
Human   306 LLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTL 370

  Fly   685 LGHELVLTEEFDKAMDYFRAAVVRDPRHYNAWYGIGTIYS--KQEKYELAEIHYVKALKINPQNS 747
            :|||.:..:....|:..:|.|:..:.|.|.||||:|..|.  |...|.|  .:|.:|.::.|.:|
Human   371 MGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCL--YYYRRAHQLRPNDS 433

  Fly   748 VILVHIGAMQFYMKKKDLSLQTLNTAATLDPKNPLTRFHR-GSI----YFSLGKYQEALRELEEL 807
            .:||.:|  :.|.|...|          ::.|....|.:. |.:    ...|.|..|.|.|.|:.
Human   434 RMLVALG--ECYEKLNQL----------VEAKKCYWRAYAVGDVEKMALVKLAKLHEQLTESEQA 486

  Fly   808 KEVVPKESVVFYLIGKIHKTLGNMD----LALMHFS---WATDLDPKGANNQIKDAFDSMAHPSC 865
            .:...|.....|..|:|.:.|....    ||..:|.   |              |...:.|. .|
Human   487 AQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLW--------------DEASTCAQ-KC 536

  Fly   866 CPANTT 871
            |..|.|
Human   537 CAFNDT 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc27NP_648093.2 ANAPC3 16..94 CDD:463743
BepA 38..168 CDD:443813
TPR repeat 68..104 CDD:276809
TPR repeat 109..143 CDD:276809
Spy 540..>753 CDD:443119 71/246 (29%)
TPR repeat 582..605 CDD:276809 6/22 (27%)
TPR 652..>809 CDD:440225 49/163 (30%)
TPR repeat 678..708 CDD:276809 8/29 (28%)
TPR repeat 713..741 CDD:276809 12/29 (41%)
TPR repeat 747..773 CDD:276809 7/25 (28%)
TPR 776..>850 CDD:440225 18/85 (21%)
TPR repeat 781..809 CDD:276809 8/32 (25%)
TPR repeat 815..838 CDD:276809 6/26 (23%)
CDC23NP_004652.2 TPR 1 27..63
ANAPC8 45..148 CDD:427675 8/26 (31%)
TPR 2 73..112
TPR 3 114..144 8/22 (36%)
TPR 4 169..200 4/30 (13%)
TPR 172..>401 CDD:440225 59/233 (25%)
TPR 5 229..259 7/34 (21%)
TPR 6 263..293 9/29 (31%)
TPR 7 297..327 9/29 (31%)
TPR 325..>495 CDD:440225 55/183 (30%)
TPR 8 331..361 13/29 (45%)
TPR repeat 331..359 CDD:276809 13/27 (48%)
TPR 9 366..395 8/28 (29%)
TPR repeat 367..393 CDD:276809 8/25 (32%)
TPR repeat 398..428 CDD:276809 12/31 (39%)
TPR 10 400..432 12/33 (36%)
TPR 11 433..466 10/44 (23%)
TPR repeat 433..461 CDD:276809 9/39 (23%)
TPR repeat 467..495 CDD:276809 7/27 (26%)
TPR 12 468..500 8/31 (26%)
TPR repeat 501..536 CDD:276809 9/49 (18%)
TPR 13 504..540 9/50 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.