DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cdc27 and CG31687

DIOPT Version :9

Sequence 1:	NP_001261503.1	Gene:	Cdc27 / 38798	FlyBaseID:	FBgn0012058	Length:	900	Species:	Drosophila melanogaster
Sequence 2:	NP_001163022.1	Gene:	CG31687 / 318886	FlyBaseID:	FBgn0051687	Length:	351	Species:	Drosophila melanogaster

Alignment Length:	102	Identity:	29/102 - (28%)
Similarity:	63/102 - (61%)	Gaps:	1/102 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   576 SSWVQSLIGLARYEMREYEAAVAIFET-IHKTEPCRLDYMEIYSSSLWHLQREVELSALAQDLIN 639
            |.::.:.:.|..:..|:.:.|:.:::. :....|.|||.::.||:.|:..:.:.|::.||...::
  Fly   249 SIYLIAQMALVYHNKRDVDKAIELYQALLESASPYRLDNVDTYSNLLFVKEMKTEMAQLAHKAVS 313

  Fly   640 QDKTSPVTWCVSGNCFSLQKEHETAIKFFKRAVQVDP 676
            .:|..|.|.||.||.:|::.:|:.||.:|:||::::|
  Fly   314 INKYRPETCCVIGNYYSIRCDHQVAISYFQRALKLNP 350

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cdc27	NP_001261503.1	ANAPC3	16..94	CDD:289650
		TPR_11	67..145	CDD:290150
		TPR repeat	68..104	CDD:276809
		TPR repeat	109..143	CDD:276809
		TPR_12	539..601	CDD:290160	4/24 (17%)
		TPR repeat	582..605	CDD:276809	3/23 (13%)
		TPR	590..850	CDD:223533	27/88 (31%)
		TPR_1	645..678	CDD:278916	14/32 (44%)
		TPR repeat	678..708	CDD:276809
		TPR_1	713..746	CDD:278916
		TPR repeat	713..741	CDD:276809
		TPR repeat	747..773	CDD:276809
		TPR repeat	781..809	CDD:276809
		TPR repeat	815..838	CDD:276809
CG31687	NP_001163022.1	ANAPC8	11..119	CDD:281973
		TPR repeat	255..278	CDD:276809	3/22 (14%)
		TPR repeat	287..314	CDD:276809	6/26 (23%)
		TPR repeat	319..347	CDD:276809	13/27 (48%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45449293
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	1.840