DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL50 and MRPL50

DIOPT Version :9

Sequence 1:NP_648092.1 Gene:mRpL50 / 38796 FlyBaseID:FBgn0028648 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_061924.1 Gene:MRPL50 / 54534 HGNCID:16654 Length:158 Species:Homo sapiens


Alignment Length:160 Identity:45/160 - (28%)
Similarity:70/160 - (43%) Gaps:21/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAILRKTLI--LAGSLHRSFASAAKAAKAKPVKTSTISAVGESIAAKGFLRPHKPYSPPADAAE 63
            ::.|.|:..:  ::|:..|.|.|..:..| :||...|:....|.|.....|| .:.|:||.|...
Human     6 VSGITRRVFMWTVSGTPCREFWSRFRKEK-EPVVVETVEEKKEPILVCPPLR-SRAYTPPEDLQS 68

  Fly    64 RIRTVA------------ASLQLKSDQLGNLSEKFEFLNACFQELQHGVPNSQVHELRTVSDVIA 116
            |:.:..            ..:.|:..:|     ||..|.....:|.|.||||::|::..|.||:.
Human    69 RLESYVKEVFGSSLPSNWQDISLEDSRL-----KFNLLAHLADDLGHVVPNSRLHQMCRVRDVLD 128

  Fly   117 FYQTAVDTTVPFDALKRIELPENLHIQYEY 146
            ||...:.....||.|....||.||.|.:.|
Human   129 FYNVPIQDRSKFDELSASNLPPNLKITWSY 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL50NP_648092.1 Ribosomal_L50 55..>124 CDD:287472 22/80 (28%)
MRPL50NP_061924.1 Ribosomal_L50 60..154 CDD:402226 29/98 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147788
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BVFW
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5421
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586864at2759
OrthoFinder 1 1.000 - - FOG0009854
OrthoInspector 1 1.000 - - oto89371
orthoMCL 1 0.900 - - OOG6_108770
Panther 1 1.100 - - LDO PTHR31542
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5290
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.