DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL50 and Mrpl50

DIOPT Version :9

Sequence 1:NP_648092.1 Gene:mRpL50 / 38796 FlyBaseID:FBgn0028648 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001102135.1 Gene:Mrpl50 / 362517 RGDID:1308008 Length:159 Species:Rattus norvegicus


Alignment Length:140 Identity:42/140 - (30%)
Similarity:64/140 - (45%) Gaps:14/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RSFASAAKAAKAKPVKTSTISAVGESIAAKGFLRP---HKPYSPPADAAERIRT-----VAASL- 72
            |.|.|.::..| :.|...|:..|.:   |...:.|   .:.|:||:|...|:.:     :.:|| 
  Rat    24 REFWSRSRKEK-ELVVAETVEEVKK---APALVCPPLRSRAYTPPSDLQSRLESHIKEVLGSSLP 84

  Fly    73 -QLKSDQLGNLSEKFEFLNACFQELQHGVPNSQVHELRTVSDVIAFYQTAVDTTVPFDALKRIEL 136
             ..:...|.:...||..|.....:|.|.||||::|::..|.||:.||...|.....||.|....|
  Rat    85 NNWQDISLDDGHVKFRLLANLADDLGHAVPNSRLHQMCRVRDVLDFYNVPVQDRSKFDELIASNL 149

  Fly   137 PENLHIQYEY 146
            |.||.|.:.|
  Rat   150 PPNLKISWNY 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL50NP_648092.1 Ribosomal_L50 55..>124 CDD:287472 24/75 (32%)
Mrpl50NP_001102135.1 Ribosomal_L50 61..155 CDD:287472 31/93 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341646
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586864at2759
OrthoFinder 1 1.000 - - FOG0009854
OrthoInspector 1 1.000 - - oto96499
orthoMCL 1 0.900 - - OOG6_108770
Panther 1 1.100 - - LDO PTHR31542
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.