DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL50 and mrpl-50

DIOPT Version :9

Sequence 1:NP_648092.1 Gene:mRpL50 / 38796 FlyBaseID:FBgn0028648 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_495899.1 Gene:mrpl-50 / 174422 WormBaseID:WBGene00011883 Length:285 Species:Caenorhabditis elegans


Alignment Length:210 Identity:62/210 - (29%)
Similarity:95/210 - (45%) Gaps:37/210 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LRKTLILAGSLHRSFASAAKAAKAKPVKTS------------TISAVG-ESIAAKGFLRPHKPYS 56
            |||||           .:.:|.::..|..|            |:|.:. ::|.|:|||:..:.|.
 Worm    40 LRKTL-----------PSIRARESTQVTASADSVTEFDDDLLTMSRIDTDAIRARGFLKYTQNYV 93

  Fly    57 PPADAAERIRTVAA----SLQLKSDQL-------GNLSEKFEFLNACFQELQHGVPNSQVHELRT 110
            |..|...::...|:    |..:||:.:       |:.|.|||.||...:.::|...|.::..|.|
 Worm    94 PGVDVKNQVLEAASSCLRSAGVKSENVDQYKFVEGDNSVKFELLNRLGKSIEHWPTNGKLLHLET 158

  Fly   111 VSDVIAFYQTAVDTTVPFDALKRIE-LPENLHIQYEYVRFHPE-TDTKFDGKTAFPKSSTLVTGL 173
            |:||:.||||.|.....:..:.|.| .|:|:.|.....||||| |.....|.||||.|...|..|
 Worm   159 VADVVEFYQTPVKNVTKYTEMARDENKPKNVSIMEHAARFHPEDTHMYHGGITAFPGSGGEVLSL 223

  Fly   174 KYRGKYEGHEAKRSW 188
            :.:......:.|:.|
 Worm   224 RQKRLLRQFQPKKEW 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL50NP_648092.1 Ribosomal_L50 55..>124 CDD:287472 26/79 (33%)
mrpl-50NP_495899.1 Ribosomal_L50 92..194 CDD:287472 31/101 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159748
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BVFW
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I3857
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009854
OrthoInspector 1 1.000 - - oto19713
orthoMCL 1 0.900 - - OOG6_108770
Panther 1 1.100 - - LDO PTHR31542
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5290
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.