DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neos and NUP116

DIOPT Version :9

Sequence 1:NP_001261502.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_013762.1 Gene:NUP116 / 855066 SGDID:S000004650 Length:1113 Species:Saccharomyces cerevisiae


Alignment Length:292 Identity:60/292 - (20%)
Similarity:109/292 - (37%) Gaps:78/292 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 EELANKAASAL---HKSTFKQNMLTVRNASIKSKAANAIAKRN-----SNQGGQVTVQGGLVMSA 118
            :|...||:..|   .|.:|| |::..|...|.|:..|..::.|     |....|.|:.|...|..
Yeast   837 DESILKASELLFNPDKRSFK-NLINNRKMLIASEEKNNGSQNNDMNFKSKSEEQETILGKPKMDE 900

  Fly   119 AAAA-AGQPLI----NDCE----------IIVQNRENT---KYAEYIEERLKNSSLRV---DVLF 162
            ...| .|:.::    ||.|          :..:|:||.   :..||.|:..|.....|   |..|
Yeast   901 KETANGGERMVLSSKNDGEDSATKHHSRNMDEENKENVADLQKQEYSEDDKKAVFADVAEKDASF 965

  Fly   163 PNEDVLLGKVLANISSRGCLYAVL-------VTPQHEEHNSITVNILYGVPAEHRNMPLEDAITL 220
            .||:..:...|..:||    |::|       :...|:.:..|.    :..|.:...:||.....:
Yeast   966 INENYYISPSLDTLSS----YSLLQLRKVPHLVVGHKSYGKIE----FLEPVDLAGIPLTSLGGV 1022

  Fly   221 ISTDFRLKKQRDAVVLPPSTSIHKGQRRHPQEMQGLLERL------------ADNHPLTASQYEV 273
            |.| |.          |.:..|:......|:..:|:..|.            :...|:....:::
Yeast  1023 IIT-FE----------PKTCIIYANLPNRPKRGEGINVRARITCFNCYPVDKSTRKPIKDPNHQL 1076

  Fly   274 ILKYLEGEREEQLKREVGEANALAKLKAPDPE 305
            :.:::     |:||:     |..:|.::.|.:
Yeast  1077 VKRHI-----ERLKK-----NPNSKFESYDAD 1098

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NeosNP_001261502.1 U2AF_lg <19..149 CDD:273727 28/112 (25%)
RRM_SF 20..78 CDD:388407 5/18 (28%)
NUP116NP_013762.1 Med15 358..>604 CDD:312941
Nucleoporin_FG2 568..>720 CDD:406391
Nucleoporin2 970..1108 CDD:397975 25/158 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.