DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neos and NUP100

DIOPT Version :9

Sequence 1:NP_001261502.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_012855.1 Gene:NUP100 / 853796 SGDID:S000001551 Length:959 Species:Saccharomyces cerevisiae


Alignment Length:341 Identity:65/341 - (19%)
Similarity:116/341 - (34%) Gaps:110/341 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDPGSAGYNITKDPALAKSRIFLGNLPVCTREELVSICQPYGKVLGSMVQKNYGFVQFETEELAN 66
            ||.||:..|...||..:    :|.     :.:.|....:.|.|.|.....||...:....:|   
Yeast   676 SDRGSSTSNSITDPESS----YLN-----SNDLLFDPDRRYLKHLVIKNNKNLNVINHNDDE--- 728

  Fly    67 KAASALHKSTFKQNMLTVRNASIKSKAANAIA------KRNSNQ-------------------GG 106
              ||.:...||     |..:||...:|:::||      |.:|.|                   .|
Yeast   729 --ASKVKLVTF-----TTESASKDDQASSSIAASKLTEKAHSPQTDLKDDHDESTPDPQSKSPNG 786

  Fly   107 QVTVQGGLVMSAAAAAAGQPLINDCEIIVQNRENTKYAEYIEERLKNSSLRVDVLFPNEDVLLGK 171
            ..::               |:|          ||.|.:..:...|.|     ||.|...:..:..
Yeast   787 STSI---------------PMI----------ENEKISSKVPGLLSN-----DVTFFKNNYYISP 821

  Fly   172 VLANISSRGCLYAVLVTPQHEEHNSITV------NILYGVPAEHRNMPLEDAITLISTDFRLKKQ 230
            .:..:.::..:       :..:.|::.:      .:.:..|.:..|.||:   ||..        
Yeast   822 SIETLGNKSLI-------ELRKINNLVIGHRNYGKVEFLEPVDLLNTPLD---TLCG-------- 868

  Fly   231 RDAVVL-PPSTSIHKGQRRHPQEMQGLLER----LADNHPLTASQYEVILKYLEGEREEQLKREV 290
             |.|.. |.|.||::.....|::.:|:..|    |....|:.    :...|.::......|||.:
Yeast   869 -DLVTFGPKSCSIYENCSIKPEKGEGINVRCRVTLYSCFPID----KETRKPIKNITHPLLKRSI 928

  Fly   291 G--EANALAKLKAPDP 304
            .  :.|.:.|.::.||
Yeast   929 AKLKENPVYKFESYDP 944

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NeosNP_001261502.1 U2AF_lg <19..149 CDD:273727 27/154 (18%)
RRM_SF 20..78 CDD:388407 11/57 (19%)
NUP100NP_012855.1 Nucleoporin_FG2 54..>246 CDD:406391
ser_rich_anae_1 <290..>566 CDD:411418
Nucleoporin_FG 429..509 CDD:404514
Nucleoporin2 814..955 CDD:397975 26/154 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.