DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neos and NUP145

DIOPT Version :9

Sequence 1:NP_001261502.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_011423.1 Gene:NUP145 / 852788 SGDID:S000003060 Length:1317 Species:Saccharomyces cerevisiae


Alignment Length:396 Identity:79/396 - (19%)
Similarity:132/396 - (33%) Gaps:92/396 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IFLGNLPVCTREELVSICQPYGKVLGSMVQ-----KNYGFVQFETEELANKAASALHKSTFKQNM 81
            |.:.|:|:...:...||......|.|....     :|.....|.:....|.......:|:....:
Yeast   232 INISNVPMAVADMPRSITSSLSDVNGKSDAEPKPIENRRTYSFSSSVSGNAPLPLASQSSLVSRL 296

  Fly    82 LTVRNASIKSKAANAI-----AKRNSNQGGQVTVQGGLVMSAAAAAAGQPLINDCEIIVQNREN- 140
            .|...|:.||.:.|.|     :|...|..|...:......|...:.|.    |:..|..||..| 
Yeast   297 STRLKATQKSTSPNEIFSPSYSKPWLNGAGSAPLVDDFFSSKMTSLAP----NENSIFPQNGFNF 357

  Fly   141 --TKYAEYIEERLKNSSLRVDVLFPNEDVLLGKVLANISSRGCLYAVLVTPQHEEHNSITVNILY 203
              ::.|:..|.|    .|::|              :|.|:...|..:..||      :||...:.
Yeast   358 LSSQRADLTELR----KLKID--------------SNRSAAKKLKLLSGTP------AITKKHMQ 398

  Fly   204 GVPAEHRNMPLEDAITLISTDFR--------------------LKKQRDAVVLPPSTSIHKGQRR 248
            .......|.|:.:|.::.:.|.:                    |.||.....|....|...|...
Yeast   399 DEQDSSENEPIANADSVTNIDRKENRDNNLDNTYLNGKEQSNNLNKQDGENTLQHEKSSSFGYWC 463

  Fly   249 HPQEMQGLLERLADNHPLTASQYEV---------------ILKYLEGEREEQLKREVGEANALAK 298
            .|...|  ||||:.......|.:.:               :..:.:..|||...:.|...::...
Yeast   464 SPSPEQ--LERLSLKQLAAVSNFVIGRRGYGCITFQHDVDLTAFTKSFREELFGKIVIFRSSKTV 526

  Fly   299 LKAPDPEIELQKKILSI-MNKPAVTDVTSELMYP----TFEAVKEDRRLMELLADDRVLAALESV 358
            ...||   |..|.::.. :|.||:  :|.|.:||    |.:.:|:..:..|....||.|.::..:
Yeast   527 EVYPD---EATKPMIGHGLNVPAI--ITLENVYPVDKKTKKPMKDTTKFAEFQVFDRKLRSMREM 586

  Fly   359 ----YN 360
                ||
Yeast   587 NYISYN 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NeosNP_001261502.1 U2AF_lg <19..149 CDD:273727 28/139 (20%)
RRM_SF 20..78 CDD:388407 11/60 (18%)
NUP145NP_011423.1 Nucleoporin_FG 34..122 CDD:404514
Nucleoporin_FG 89..209 CDD:404514
Nucleoporin2 460..605 CDD:397975 31/140 (22%)
Nup96 898..1150 CDD:403363
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.