DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neos and NUP49

DIOPT Version :9

Sequence 1:NP_001261502.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_011343.1 Gene:NUP49 / 852703 SGDID:S000003140 Length:472 Species:Saccharomyces cerevisiae


Alignment Length:95 Identity:19/95 - (20%)
Similarity:40/95 - (42%) Gaps:20/95 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 NSNQGGQVTVQGGLV------------MSAAAAAAGQ----PLINDCEIIVQNRENTKYA-EYIE 148
            |:|....::..|||.            |..|.....|    |:....|:..|.|:..:.. :||:
Yeast   221 NNNSNNIMSASGGLFGNQQQQLQQQPQMQCALQNLSQLPITPMTRISELPPQIRQEIEQLDQYIQ 285

  Fly   149 ERLKNS-SLRVDVLFPNEDVLLGKVLANIS 177
            ::::.| .|:.|.:  :.|.|:..:..:::
Yeast   286 KQVQISHHLKADTI--DHDELIDSIPRDVA 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NeosNP_001261502.1 U2AF_lg <19..149 CDD:273727 14/64 (22%)
RRM_SF 20..78 CDD:388407
NUP49NP_011343.1 Nucleoporin_FG2 29..>289 CDD:406391 14/67 (21%)
V_Alix_like <267..465 CDD:353824 10/49 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.