DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neos and NUP42

DIOPT Version :9

Sequence 1:NP_001261502.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_010478.3 Gene:NUP42 / 851774 SGDID:S000002600 Length:430 Species:Saccharomyces cerevisiae


Alignment Length:305 Identity:57/305 - (18%)
Similarity:92/305 - (30%) Gaps:108/305 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LVSICQPYGKVLGSM--------------------------------------VQKNYGFVQFET 61
            :.:...|:||..|||                                      ....:|.:|...
Yeast   127 MAATSNPFGKSPGSMGSAFGQPAFGANKTAIPSSSVSNSNNSAFGAASNTPLTTTSPFGSLQQNA 191

  Fly    62 EELANKAASALHKSTF------KQNMLTVRNASIKSKAA----NAIAKRNSNQGGQVTVQGGLVM 116
            .:.|:..:||..|.||      :....|::|.|..|...    ......::|:.....:|.|   
Yeast   192 SQNASSTSSAFGKPTFGAATNTQSPFGTIQNTSTSSGTGVSPFGTFGTNSNNKSPFSNLQSG--- 253

  Fly   117 SAAAAAAGQPLINDCEIIVQNRENTKYAEY-------------------IEERLKNSSLRVDVLF 162
                |.||............|..|...:.:                   .....||::......|
Yeast   254 ----AGAGSSPFGTTTSKANNNNNVGSSAFGTTNNQSPFSGGSGGTFGSASNLNKNTNGNFQSSF 314

  Fly   163 PNEDVLLGKVLANISSRGCLYAVLVTPQHEEHNSITVNILYGVPAEHRNMPLEDA-ITLIS---- 222
            .|:....|                :|||::.:.....|..:|     :.||..|. |:|.|    
Yeast   315 GNKGFSFG----------------ITPQNDANKVSQSNPSFG-----QTMPNTDPNISLKSNGNA 358

  Fly   223 TDFRL-KKQRDAVVLPPSTSIHKGQRRHPQ----EMQGLLERLAD 262
            |.|.. ::|.:|..:..:|:  .|:.|..|    |..|:|| |||
Yeast   359 TSFGFGQQQMNATNVNANTA--TGKIRFVQGLSSEKDGILE-LAD 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NeosNP_001261502.1 U2AF_lg <19..149 CDD:273727 26/180 (14%)
RRM_SF 20..78 CDD:388407 14/86 (16%)
NUP42NP_010478.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.