DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neos and RS41

DIOPT Version :10

Sequence 1:NP_523955.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_200017.2 Gene:RS41 / 835279 AraportID:AT5G52040 Length:357 Species:Arabidopsis thaliana


Alignment Length:48 Identity:15/48 - (31%)
Similarity:30/48 - (62%) Gaps:0/48 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QPYGKVLGSMVQKNYGFVQFETEELANKAASALHKSTFKQNMLTVRNA 87
            :||||::...:::|:.|:|:|.:|.|.:|..|.:.|.....:::|..|
plant   118 EPYGKIVNVRIRRNFAFIQYEAQEDATRALDATNSSKLMDKVISVEYA 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NeosNP_523955.1 U2AF_lg <19..149 CDD:273727 15/48 (31%)
RRM_SF 20..78 CDD:473069 13/37 (35%)
RS41NP_200017.2 RRM1_AtRSp31_like 2..73 CDD:409680
RRM2_AtRSp31_like 97..166 CDD:409899 15/48 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.