DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neos and RS31

DIOPT Version :10

Sequence 1:NP_523955.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_567120.1 Gene:RS31 / 825359 AraportID:AT3G61860 Length:264 Species:Arabidopsis thaliana


Alignment Length:99 Identity:32/99 - (32%)
Similarity:53/99 - (53%) Gaps:10/99 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KDPALAK--SRIFLGNL-PVCTRE-ELVSICQPYGKVLGSMVQKNYGFVQFETEELANKAASALH 73
            |.|:..|  ..:|:.|. |:.|:| ::....:|||||....:::|:.||||||:|.|.||..|..
plant    84 KAPSNLKPTKTLFVINFDPIRTKEHDIEKHFEPYGKVTNVRIRRNFSFVQFETQEDATKALEATQ 148

  Fly    74 KSTFKQNMLTVRNASIKSKAANAIAKRNSNQGGQ 107
            :|.....:::|..| :|..     .:|:...||:
plant   149 RSKILDRVVSVEYA-LKDD-----DERDDRNGGR 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NeosNP_523955.1 U2AF_lg <19..149 CDD:273727 30/93 (32%)
RRM_SF 20..78 CDD:473069 23/59 (39%)
RS31NP_567120.1 RRM_SF 2..73 CDD:473069
RRM2_AtRSp31_like 94..163 CDD:409899 25/69 (36%)
PTZ00449 <138..209 CDD:185628 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.