DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neos and Nup98

DIOPT Version :9

Sequence 1:NP_001261502.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_112336.2 Gene:Nup98 / 81738 RGDID:71033 Length:1816 Species:Rattus norvegicus


Alignment Length:186 Identity:43/186 - (23%)
Similarity:74/186 - (39%) Gaps:34/186 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 RNMPLEDAITLISTDFRLKKQRDAV--------VLP-PSTSIHKGQ----RRHPQEMQGLLERLA 261
            |...|::.:.|..|...||.:...|        ::| |..|:..|.    ::.|::   |||...
  Rat  1203 RQRKLDEDLQLYQTPLELKLKHSTVHVDELCPLIVPNPGVSVIHGYADWVKKSPRD---LLELPI 1264

  Fly   262 DNH-PLTASQYEVI---LKYLEGEREE------QLKREVGEANALAKLKAPDPEIELQKKILSIM 316
            ..| .||.:..|.:   ||.|:.:.:|      .|:|....:..|:...||..|.|:.   |:..
  Rat  1265 VKHWSLTWTLCEALWGHLKELDSQLDEPSEYIQTLERRRAFSRWLSHTAAPQIEEEVS---LTRR 1326

  Fly   317 NKPAVTDVTSELMYPTFEAVKEDRRLMELLADDRVLAALESVYNS-DLRQILAEYL 371
            :.|    :.:...|.|...:.|...|.:...|.|:...|..:..| .:|::|...|
  Rat  1327 DSP----IEAVFSYLTGSRISEACCLAQQSGDHRLALLLSQLVGSQSVRELLTMQL 1378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NeosNP_001261502.1 U2AF_lg <19..149 CDD:273727
RRM_SF 20..78 CDD:388407
Nup98NP_112336.2 FG repeats 1 1..156
Nucleoporin_FG 25..149 CDD:290362
NupH_GANP 26..336 CDD:293373
GLEBS, interaction with RAE1. /evidence=ECO:0000250 157..213
FG repeats 2 214..480
Nucleoporin_FG 215..303 CDD:290362
Nucleoporin_FG 261..392 CDD:290362
Nucleoporin2 740..880 CDD:282016
Nup96 1333..1624 CDD:288926 11/46 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.