DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neos and nup98

DIOPT Version :9

Sequence 1:NP_001261502.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_956979.2 Gene:nup98 / 777756 ZFINID:ZDB-GENE-040426-1180 Length:1814 Species:Danio rerio


Alignment Length:242 Identity:54/242 - (22%)
Similarity:90/242 - (37%) Gaps:66/242 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 QVTVQGGLVMSAAA-----AAAGQPLINDCEIIVQNRENTKYAEY----------IEERLKNSSL 156
            |..|...|:...|:     :.||:|.|.   .::||:..:....:          |.::| |.||
Zfish  1020 QEHVSSKLIQDVASTKLLLSGAGRPSIG---ALLQNKFTSGGGLFSQLPEVPFSGISQKL-NKSL 1080

  Fly   157 RVDVLFPNEDVLLGKVLANISSRGCLYAVLVTPQHEEHNSITVNI-LYGVPAEHRNMPLEDAITL 220
            ..:..:|:    ||.            :.|:.|...|....||.. ..|.|     :|||.:|||
Zfish  1081 ASEAAWPS----LGP------------SFLLPPPPPEPTLRTVGARRLGGP-----VPLEASITL 1124

  Fly   221 ----ISTDFRLKKQRDAVV--LPPSTSIHKGQR---RHPQEMQ-------GLLERLADNHPLTAS 269
                :..|..|.:.|...|  .|..|.:|.|.:   .||.:..       |.|.:.....|:|.|
Zfish  1125 GKGRLLMDAALFRGRSFRVGWGPNWTLVHSGDQLSVTHPVKEPAAENLGFGFLPKPTKTKPITES 1189

  Fly   270 QYEVILKYLEGEREEQLKR---------EVGEANALAKLKAPDPEIE 307
            .::|.::.:.|...:|...         |:|..::....:.|.|.|:
Zfish  1190 PFKVRVEQVVGLEPKQSSESLSLYLRPLEIGLKHSTINTEEPCPFIQ 1236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NeosNP_001261502.1 U2AF_lg <19..149 CDD:273727 11/56 (20%)
RRM_SF 20..78 CDD:388407
nup98NP_956979.2 Nucleoporin_FG 39..133 CDD:290362
Nucleoporin_FG 217..357 CDD:290362
Nucleoporin_FG 324..>400 CDD:290362
Nucleoporin2 741..881 CDD:282016
Nup96 1333..1626 CDD:288926
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.