DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neos and Nup98-96

DIOPT Version :9

Sequence 1:NP_001261502.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001262885.1 Gene:Nup98-96 / 42816 FlyBaseID:FBgn0039120 Length:1960 Species:Drosophila melanogaster


Alignment Length:411 Identity:70/411 - (17%)
Similarity:131/411 - (31%) Gaps:123/411 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SDPGSAGYNITKDPALAKSRIFLGNLPVCTREEL---VSICQPYGKVLGSMVQKNYGFVQFETEE 63
            :.||:.....::|....:|.:...||....:..:   :....|:...|..:|.:. ....:....
  Fly   746 NSPGATNGRESQDNGRRESWLHPNNLEKVRQHNIQTGMDQGSPHNSTLNELVPRK-PLDTYRPSS 809

  Fly    64 LANKAASALHKSTFKQNMLTV-RNASIKSKAAN--AIAKRNSNQGGQVTVQGGLVMSAAAAAAGQ 125
            ....:.|.:.::.|:....|: |..:..|:.||  .::.|::........|..|.:.||||.|..
  Fly   810 TVRLSVSTIPENPFEDQSSTIARRETFTSQQANESVLSNRSNEAEDSAANQSRLAIEAAAAEAAD 874

  Fly   126 P--------------------------LINDCEIIVQN----RENTKYAE-YIEERLKNSSLRVD 159
            .                          |..|...:|.|    ||.  |.. :..:.:..:.|.:|
  Fly   875 DESHPTGIVLRRVGYYTIPSLDDLRSYLAEDGSCVVPNFTVGREG--YGNVFFGKEMDVAGLNLD 937

  Fly   160 --VLFPNEDVLLGKVLANISSRGCLYAVLVTPQHEEHNSITVNILYGVPAEHRNMPL-----EDA 217
              |.|.|:::                                 |:|  |.:....|:     .||
  Fly   938 EIVHFRNKEI---------------------------------IIY--PDDENKPPIGQGLNRDA 967

  Fly   218 ITLISTDFRLKKQRDAVVLPPSTSIHKGQRRHPQEMQGLLERLADNH--------PLTAS---QY 271
            ...:...:.|.|.:...:..|       ||....:.:|.|.|:.|.:        |.|.|   :.
  Fly   968 QVTLDQVWPLDKTKHEAIKDP-------QRLLEMDWEGKLRRVCDKNDTRFIEYRPETGSWVFRV 1025

  Fly   272 EVILKYLEGEREEQLKREVGEANALAKLKAPDPEIELQKKILSIMNKPAVTDVTSELMYPTFEAV 336
            :...||..|:.:|                  :.|:....|...|....|.....:|.|  |..::
  Fly  1026 KHFSKYGLGDSDE------------------EDELPTDPKKAKIATLEAQQRANAEKM--TLNSL 1070

  Fly   337 KEDRRLMELLA---DDRVLAA 354
            ::.:::.|..|   |.:.|.|
  Fly  1071 RQAQKISEDAARNLDPKALVA 1091

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NeosNP_001261502.1 U2AF_lg <19..149 CDD:273727 28/166 (17%)
RRM_SF 20..78 CDD:388407 7/60 (12%)
Nup98-96NP_001262885.1 Nucleoporin_FG 395..481 CDD:316182
Nucleoporin2 888..1027 CDD:309287 30/182 (16%)
Nup96 1484..1762 CDD:314912
Nucleoporin_FG <1..74 CDD:316182
Nucleoporin_FG 50..164 CDD:316182
Nucleoporin_FG 254..318 CDD:316182
NupH_GANP 316..>522 CDD:318883
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.