DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neos and raly

DIOPT Version :9

Sequence 1:NP_001261502.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_991173.1 Gene:raly / 402903 ZFINID:ZDB-GENE-041010-127 Length:273 Species:Danio rerio


Alignment Length:297 Identity:69/297 - (23%)
Similarity:104/297 - (35%) Gaps:89/297 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NIT--KDPALAKSRIFLGNL--PVCTREELVSICQPYGKVLGSMVQKNYGFVQFETEELANKAAS 70
            |||  .||....||:|:|||  .|..:.::.:|...||:|||..|.|.|.|||:..|..|.    
Zfish     9 NITNKNDPKSINSRVFIGNLNTAVVKKSDVETIFSKYGRVLGCSVHKGYAFVQYANERHAR---- 69

  Fly    71 ALHKSTFKQNMLTVRNASIKSKAANAIAKRNSNQGGQVTVQGGLVMSAAAAAAGQPLINDCEIIV 135
                                               |.|..:.|.|:      |||.|  |..:..
Zfish    70 -----------------------------------GAVIGENGRVL------AGQTL--DINMAG 91

  Fly   136 QNRENTKYAEYIEERLKNSSLRVDVLFPNEDVLLGKVLANISSRGCLYAVLVTPQHEEHNSITVN 200
            :.:.|.      .:.||.|:.   .|:...|........:...|...|...|:|           
Zfish    92 EPKPNR------PKGLKRSAA---TLYSGYDFDYDYYRDDFYDRLFEYRGRVSP----------- 136

  Fly   201 ILYGVPAEHRNMPLEDAITLISTDFRLKK------QRDAVVLPPSTSIHKGQRRHPQEMQGLLER 259
                ||   |.:|::.....:....|:|.      .|.| :||.|:..||.:....|.::..|.:
Zfish   137 ----VP---RAVPVKRPRVAVPVVRRVKSLPVKLLTRSA-ILPNSSVKHKLKSTELQAIKSELTQ 193

  Fly   260 LADNHPLTASQYEVIL--KY--LEGEREEQLKREVGE 292
            :..|......:.:.|.  ||  .|.::.|.||.|..:
Zfish   194 IKSNIDALLGRLDQITEDKYCSTELQKAEDLKSEASQ 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NeosNP_001261502.1 U2AF_lg <19..149 CDD:273727 31/131 (24%)
RRM_SF 20..78 CDD:388407 21/59 (36%)
ralyNP_991173.1 RRM_RALY 20..95 CDD:241048 30/121 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5288
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.