DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neos and ncoa5

DIOPT Version :9

Sequence 1:NP_001261502.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_988936.1 Gene:ncoa5 / 394533 XenbaseID:XB-GENE-5926600 Length:625 Species:Xenopus tropicalis


Alignment Length:263 Identity:75/263 - (28%)
Similarity:128/263 - (48%) Gaps:63/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 AGQPLINDCEIIVQNRENTKYAEYIEERLKNSSLRVDVLFPNEDVLLGKVLANISSRGCLYAVLV 187
            |.:|:  ||.::|.|:::.:|||.:..::::..:.||::|.|.:|.|.:.|.:::..|..:|:::
 Frog   214 AERPV--DCSVVVVNKQSKEYAESVGRKVRDLGMMVDLIFLNTEVSLTQALEDVTRGGSPFAIVI 276

  Fly   188 TPQHEEHNSITVNILYGVPAEHRNMPLEDAITLISTDF-RLK-----KQR------------DAV 234
            |.||:.|.|.|||||:|.|.|||||||.||:.||:.:: |.|     |:|            ||:
 Frog   277 TQQHQVHRSCTVNILFGTPQEHRNMPLADAMVLIARNYERFKSETREKEREDIARQAAKMSADAI 341

  Fly   235 VLPP---STSIHKGQRRHPQEMQGLLERLADNHPLTASQYEVILKYLEGERE-----------EQ 285
            :...   :..:.:|..  |..:|.:|..||||..:|..:.:.::.||..::|           .|
 Frog   342 LRERALLAEEVVRGPA--PPGIQAVLGLLADNRYVTVEEIDKVIHYLRDKKERLLGAPSDSLPSQ 404

  Fly   286 LKREVGEANALAKLK------APDPEI---------------------ELQKKILSIMNKPAVTD 323
            |.|....|..::.|.      |.:|.:                     |||.||||:.|..:...
 Frog   405 LSRPSMGAAPVSSLDNQTSGLANNPALQMTQTISSASPAGQSVNTSQQELQAKILSLFNSGSAVG 469

  Fly   324 VTS 326
            .:|
 Frog   470 ASS 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NeosNP_001261502.1 U2AF_lg <19..149 CDD:273727 9/25 (36%)
RRM_SF 20..78 CDD:388407
ncoa5NP_988936.1 PRK12678 <5..>152 CDD:237171
dermokine <395..>589 CDD:416092 16/78 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D421126at33208
OrthoFinder 1 1.000 - - FOG0006056
OrthoInspector 1 1.000 - - otm47964
Panther 1 1.100 - - LDO PTHR23295
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5288
SonicParanoid 1 1.000 - - X5759
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.050

Return to query results.
Submit another query.