DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neos and Ncoa5

DIOPT Version :9

Sequence 1:NP_001261502.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001100013.1 Gene:Ncoa5 / 296372 RGDID:1307702 Length:578 Species:Rattus norvegicus


Alignment Length:255 Identity:79/255 - (30%)
Similarity:126/255 - (49%) Gaps:60/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 AGQPLINDCEIIVQNRENTKYAEYIEERLKNSSLRVDVLFPNEDVLLGKVLANISSRGCLYAVLV 187
            |.:|:  ||.:||.|::...|||.:..::::..:.||::|.|.:|.|.:.|.::|..|..:|:::
  Rat   193 AERPV--DCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVI 255

  Fly   188 TPQHEEHNSITVNILYGVPAEHRNMPLEDAITLISTDF-RLK-----KQRDAVVLPPSTSIHK-- 244
            |.||:.|.|.||||::|.|.||||||..||:.|::.:: |.|     |:|:.:....:...:.  
  Rat   256 TQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNDCREKEREEIARQAAKMANDAI 320

  Fly   245 ------------GQRRHPQEMQGLLERLADNHPLTASQYEVILKYLEGEREEQLKRE-------- 289
                        |:..||..:|.|:..||||..|||.:.:.|:.||. ||:|:|.|.        
  Rat   321 LQERDRGGPEEGGRGGHPPAIQSLINLLADNRYLTAEETDKIINYLR-ERKERLLRSSADSLPGP 384

  Fly   290 -----VGEANALAKLKA-----------------------PDPEIELQKKILSIMNKPAV 321
                 :|.|:. :.||.                       |..:.|||.||||:.|..||
  Rat   385 ISRQPLGAASG-SSLKTQPSSQPLQSGQVLPSATPTPAAPPTSQQELQAKILSLFNSGAV 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NeosNP_001261502.1 U2AF_lg <19..149 CDD:273727 10/25 (40%)
RRM_SF 20..78 CDD:388407
Ncoa5NP_001100013.1 HisS <185..255 CDD:223202 20/63 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350399
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D421126at33208
OrthoFinder 1 1.000 - - FOG0006056
OrthoInspector 1 1.000 - - oto96243
orthoMCL 1 0.900 - - OOG6_109699
Panther 1 1.100 - - LDO PTHR23295
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5759
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.710

Return to query results.
Submit another query.