DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Neos and ztf-4

DIOPT Version :9

Sequence 1:NP_001261502.1 Gene:Neos / 38795 FlyBaseID:FBgn0024542 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_491976.2 Gene:ztf-4 / 172422 WormBaseID:WBGene00020399 Length:367 Species:Caenorhabditis elegans


Alignment Length:334 Identity:81/334 - (24%)
Similarity:126/334 - (37%) Gaps:117/334 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GSAGYN-------ITKDPALAKSRIFLGNL--PVCTREELVSICQPYGKVL--GSMVQKNYGFVQ 58
            |||..|       .:|||.:.::|:|:||:  .:.||::::.:.:|:||::  ....|:.:||||
 Worm    61 GSAAVNSDISYDTSSKDPHMIRARVFIGNIARAIITRDDIIELFRPFGKIIAVNYFAQQGFGFVQ 125

  Fly    59 FETEELANKAASALHKSTFKQNMLTVRNASIKSKAANAIAKRNSNQGGQVTVQGGLVMSAAAAAA 123
            |.....|:::..:|:..::|...|.|..|.:.|     :.|...|:|.|     |..::.|....
 Worm   126 FNEAGSADESCRSLNGMSWKACCLDVHLAMLGS-----LRKPTGNEGRQ-----GNTIAPAPLPV 180

  Fly   124 GQPLI-----------------NDCEIIVQNRENTKYAEYIEERLKNSSLRV-DVLFPNE--DVL 168
            |:||.                 .:.||..||:.|.::|        |....: :.|.|||  |.:
 Worm   181 GKPLTQHAVDTSAQSAKRPYEDEEYEIFKQNKRNKQFA--------NGDTTINEQLAPNEMCDTM 237

  Fly   169 LGKVLANISSRGCLYAVLVTPQHE---EHNSITVNILYGVPAEHRNMPLEDAITLISTDFRLK-- 228
            :           |.|...||...|   ||.....| .|..|.|.|:              |||  
 Worm   238 V-----------CGYCRFVTSDFEEFKEHRIAGCN-KYKDPEEPRH--------------RLKCA 276

  Fly   229 --KQRDAVVLPPSTSIHKGQRRHPQEMQGLLERLADNHPLTASQYEVILKYLEGEREEQLKREVG 291
              .||..                  ...||||.|.|.|.:        |.|.|         |..
 Worm   277 TCSQRFL------------------GAWGLLEHLTDFHRM--------LLYTE---------EKM 306

  Fly   292 EANALAKLK 300
            ..|.||:::
 Worm   307 TPNDLAQMR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NeosNP_001261502.1 U2AF_lg <19..149 CDD:273727 37/150 (25%)
RRM_SF 20..78 CDD:388407 17/61 (28%)
ztf-4NP_491976.2 RRM <64..272 CDD:223796 59/251 (24%)
RRM_SF 83..151 CDD:388407 19/67 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto17547
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5288
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.