powered by:
Protein Alignment Neos and plg-1
DIOPT Version :9
Sequence 1: | NP_001261502.1 |
Gene: | Neos / 38795 |
FlyBaseID: | FBgn0024542 |
Length: | 371 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001364773.1 |
Gene: | plg-1 / 13190610 |
WormBaseID: | WBGene00004041 |
Length: | 116 |
Species: | Caenorhabditis elegans |
Alignment Length: | 50 |
Identity: | 12/50 - (24%) |
Similarity: | 22/50 - (44%) |
Gaps: | 17/50 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 167 VLLGKVLANISSRGCLYAVLVTPQHEEHNSITVNILYGVPAEHRNMPLED 216
:|:|.:| |:|::: |.:..:|| .|..||:....|
Worm 3 LLIGILL--------LFALVI---HHDVLAIT------RPDRHRHRKTHD 35
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Neos | NP_001261502.1 |
U2AF_lg |
<19..149 |
CDD:273727 |
|
RRM_SF |
20..78 |
CDD:388407 |
|
plg-1 | NP_001364773.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0845 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.