DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL18 and RPL18A

DIOPT Version :9

Sequence 1:NP_001261501.1 Gene:RpL18 / 38794 FlyBaseID:FBgn0035753 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_014521.1 Gene:RPL18A / 854029 SGDID:S000005480 Length:186 Species:Saccharomyces cerevisiae


Alignment Length:188 Identity:108/188 - (57%)
Similarity:132/188 - (70%) Gaps:4/188 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGIDINHK-YDRKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKRLFMSKINRPPLSLQ 64
            ||||...| :.|...||.|||.:|||:||||||.||.|||:..||:::||.||:|||||||:|:.
Yeast     1 MGIDHTSKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTDAPFNKVVLKALFLSKINRPPVSVS 65

  Fly    65 RIARFFKAANQPESTIVVVGTVTDDARLLVVPKLTVCALHVTQTARERILKAGGEVLTFDQLALR 129
            ||||..|.......|:|||||||||||:...||.||.||..|..||.:|:|||||.:|.||||:|
Yeast    66 RIARALKQEGAANKTVVVVGTVTDDARIFEFPKTTVAALRFTAGARAKIVKAGGECITLDQLAVR 130

  Fly   130 SPTGKNTLLLQGRRTARTACKHFGKAPGVPHSHTRPYVRSKGRKFERARGRRSSCGYK 187
            :|.|:|||:|:|.|.:|.|.:|||..   ||....|.:.|.|||||||||||.|.|:|
Yeast   131 APKGQNTLILRGPRNSREAVRHFGMG---PHKGKAPRILSTGRKFERARGRRRSKGFK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL18NP_001261501.1 Ribosomal_L18e 11..188 CDD:299869 103/177 (58%)
RPL18ANP_014521.1 Ribosomal_L18 2..186 CDD:407269 107/187 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342045
Domainoid 1 1.000 203 1.000 Domainoid score I543
eggNOG 1 0.900 - - E1_COG1727
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H756
Inparanoid 1 1.050 205 1.000 Inparanoid score I836
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54131
OrthoFinder 1 1.000 - - FOG0002775
OrthoInspector 1 1.000 - - otm46890
orthoMCL 1 0.900 - - OOG6_100803
Panther 1 1.100 - - LDO PTHR10934
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1112
SonicParanoid 1 1.000 - - X1864
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.