DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL18 and RPL18

DIOPT Version :9

Sequence 1:NP_001261501.1 Gene:RpL18 / 38794 FlyBaseID:FBgn0035753 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_187210.1 Gene:RPL18 / 819725 AraportID:AT3G05590 Length:187 Species:Arabidopsis thaliana


Alignment Length:188 Identity:115/188 - (61%)
Similarity:142/188 - (75%) Gaps:3/188 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGID-INHKYDRKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKRLFMSKINRPPLSLQ 64
            |||| |.....:|.:||.|||.||||:|.|||||||.||||.|||.:|||||||||:|:.||||.
plant     1 MGIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKFNGVILKRLFMSKVNKAPLSLS 65

  Fly    65 RIARFFKAANQPESTIVVVGTVTDDARLLVVPKLTVCALHVTQTARERILKAGGEVLTFDQLALR 129
            |:..|.  ..:.:...|:|||:|||.|:..:|.:.|.||..|:.||.||.|||||.|||||||||
plant    66 RLVEFM--TGKEDKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALR 128

  Fly   130 SPTGKNTLLLQGRRTARTACKHFGKAPGVPHSHTRPYVRSKGRKFERARGRRSSCGYK 187
            :|.|:||:||:|.:.:|.|.||||.||||||||::||||:||||||:|||:|.|.|:|
plant   129 APLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKRKSRGFK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL18NP_001261501.1 Ribosomal_L18e 11..188 CDD:299869 110/177 (62%)
RPL18NP_187210.1 Ribosomal_L18 2..187 CDD:407269 114/187 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 224 1.000 Domainoid score I692
eggNOG 1 0.900 - - E1_COG1727
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H756
Inparanoid 1 1.050 226 1.000 Inparanoid score I1166
OMA 1 1.010 - - QHG54131
OrthoDB 1 1.010 - - D1303996at2759
OrthoFinder 1 1.000 - - FOG0002775
OrthoInspector 1 1.000 - - otm2972
orthoMCL 1 0.900 - - OOG6_100803
Panther 1 1.100 - - O PTHR10934
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1864
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.