DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL18 and AT2G47570

DIOPT Version :9

Sequence 1:NP_001261501.1 Gene:RpL18 / 38794 FlyBaseID:FBgn0035753 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001318441.1 Gene:AT2G47570 / 819370 AraportID:AT2G47570 Length:186 Species:Arabidopsis thaliana


Alignment Length:178 Identity:110/178 - (61%)
Similarity:131/178 - (73%) Gaps:3/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKRLFMSKINRPPLSLQRIARFFKAANQ 75
            :|.:||||||.||||:||||..|:|.|||..|||.:|||||||||:|:.||||.|:.|:..  .:
plant    10 KKTKRTEPKSDDVYLKLLVKANRYLVRRTESKFNAVILKRLFMSKVNKAPLSLSRLVRYMD--GK 72

  Fly    76 PESTIVVVGTVTDDARLLVVPKLTVCALHVTQTARERILKAGGEVLTFDQLALRSPT-GKNTLLL 139
            .....|:|||||||.|:..||.|||.||..|::||.||.|||||.||||||||..|| .:||:||
plant    73 DGKIAVIVGTVTDDVRIEDVPALTVTALRFTESARARIHKAGGECLTFDQLALPCPTWSENTVLL 137

  Fly   140 QGRRTARTACKHFGKAPGVPHSHTRPYVRSKGRKFERARGRRSSCGYK 187
            :|.:..|.|.||||.|||||||||:||||..|:|.|.|||||.|.|:|
plant   138 RGPKNTREAVKHFGPAPGVPHSHTKPYVRQTGKKIEIARGRRRSRGFK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL18NP_001261501.1 Ribosomal_L18e 11..188 CDD:299869 110/178 (62%)
AT2G47570NP_001318441.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 224 1.000 Domainoid score I692
eggNOG 1 0.900 - - E1_COG1727
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 226 1.000 Inparanoid score I1166
OMA 1 1.010 - - QHG54131
OrthoDB 1 1.010 - - D1303996at2759
OrthoFinder 1 1.000 - - FOG0002775
OrthoInspector 1 1.000 - - otm2972
orthoMCL 1 0.900 - - OOG6_100803
Panther 1 1.100 - - O PTHR10934
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1864
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.