DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL18 and Rpl18

DIOPT Version :9

Sequence 1:NP_001261501.1 Gene:RpL18 / 38794 FlyBaseID:FBgn0035753 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_006229223.1 Gene:Rpl18 / 81766 RGDID:621182 Length:193 Species:Rattus norvegicus


Alignment Length:186 Identity:130/186 - (69%)
Similarity:148/186 - (79%) Gaps:0/186 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GIDINHKYDRKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKRLFMSKINRPPLSLQRI 66
            |:||.|..||||||.||||||:||||||||||||.||||..||:::|||||||:.|||||||.|:
  Rat     7 GVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSRM 71

  Fly    67 ARFFKAANQPESTIVVVGTVTDDARLLVVPKLTVCALHVTQTARERILKAGGEVLTFDQLALRSP 131
            .|..|...:...|.|||||:|||.|:|.||||.||||.|:..||.|||||||::||||||||.||
  Rat    72 IRKMKLPGRENKTAVVVGTITDDVRILEVPKLKVCALRVSSRARSRILKAGGKILTFDQLALESP 136

  Fly   132 TGKNTLLLQGRRTARTACKHFGKAPGVPHSHTRPYVRSKGRKFERARGRRSSCGYK 187
            .|:.|:||.|.|..|...:|||||||.|||||:|||||||||||||||||:|.|||
  Rat   137 KGRGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL18NP_001261501.1 Ribosomal_L18e 11..188 CDD:299869 125/177 (71%)
Rpl18XP_006229223.1 Ribosomal_L18e 16..192 CDD:299869 123/175 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337149
Domainoid 1 1.000 266 1.000 Domainoid score I1812
eggNOG 1 0.900 - - E1_COG1727
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H756
Inparanoid 1 1.050 268 1.000 Inparanoid score I2946
OMA 1 1.010 - - QHG54131
OrthoDB 1 1.010 - - D1303996at2759
OrthoFinder 1 1.000 - - FOG0002775
OrthoInspector 1 1.000 - - oto97945
orthoMCL 1 0.900 - - OOG6_100803
Panther 1 1.100 - - LDO PTHR10934
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1864
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.