DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL18 and RPL18

DIOPT Version :9

Sequence 1:NP_001261501.1 Gene:RpL18 / 38794 FlyBaseID:FBgn0035753 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_000970.1 Gene:RPL18 / 6141 HGNCID:10310 Length:188 Species:Homo sapiens


Alignment Length:187 Identity:130/187 - (69%)
Similarity:147/187 - (78%) Gaps:0/187 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGIDINHKYDRKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKRLFMSKINRPPLSLQR 65
            ||:||.|..||||||.||||||:||||||||||||.||||..||:::|||||||:.|||||||.|
Human     1 MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPPLSLSR 65

  Fly    66 IARFFKAANQPESTIVVVGTVTDDARLLVVPKLTVCALHVTQTARERILKAGGEVLTFDQLALRS 130
            :.|..|...:...|.|||||:|||.|:..||||.||||.||..||.|||:|||::||||||||.|
Human    66 MIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVCALRVTSRARSRILRAGGKILTFDQLALDS 130

  Fly   131 PTGKNTLLLQGRRTARTACKHFGKAPGVPHSHTRPYVRSKGRKFERARGRRSSCGYK 187
            |.|..|:||.|.|..|...:|||||||.|||||:|||||||||||||||||:|.|||
Human   131 PKGCGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRRASRGYK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL18NP_001261501.1 Ribosomal_L18e 11..188 CDD:299869 124/177 (70%)
RPL18NP_000970.1 Ribosomal_L18 2..176 CDD:407269 118/173 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..188 33/37 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143397
Domainoid 1 1.000 262 1.000 Domainoid score I1968
eggNOG 1 0.900 - - E1_COG1727
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H756
Inparanoid 1 1.050 264 1.000 Inparanoid score I3085
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54131
OrthoDB 1 1.010 - - D1303996at2759
OrthoFinder 1 1.000 - - FOG0002775
OrthoInspector 1 1.000 - - oto90848
orthoMCL 1 0.900 - - OOG6_100803
Panther 1 1.100 - - LDO PTHR10934
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1112
SonicParanoid 1 1.000 - - X1864
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.