DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL18 and rpl18

DIOPT Version :9

Sequence 1:NP_001261501.1 Gene:RpL18 / 38794 FlyBaseID:FBgn0035753 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001011030.1 Gene:rpl18 / 496439 XenbaseID:XB-GENE-1006303 Length:188 Species:Xenopus tropicalis


Alignment Length:187 Identity:128/187 - (68%)
Similarity:148/187 - (79%) Gaps:0/187 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGIDINHKYDRKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKRLFMSKINRPPLSLQR 65
            ||:||.|..||||||.||||||:||||||||||||.||||..|||::|||||||:.|||||||.|
 Frog     1 MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSSFNRVVLKRLFMSRTNRPPLSLSR 65

  Fly    66 IARFFKAANQPESTIVVVGTVTDDARLLVVPKLTVCALHVTQTARERILKAGGEVLTFDQLALRS 130
            :.|..|...:...|.||||.:|||.|:..:|||.||||.:|..||.|||||||:::|||||||.:
 Frog    66 LIRKMKLTGRENKTAVVVGCITDDVRIHDIPKLKVCALKMTGGARSRILKAGGQIMTFDQLALAA 130

  Fly   131 PTGKNTLLLQGRRTARTACKHFGKAPGVPHSHTRPYVRSKGRKFERARGRRSSCGYK 187
            |.|:||:||.|.|.||...:|||||||.|||||:|||.|||||||||||||:|.|||
 Frog   131 PKGQNTVLLSGPRKAREVYRHFGKAPGTPHSHTKPYVLSKGRKFERARGRRASRGYK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL18NP_001261501.1 Ribosomal_L18e 11..188 CDD:299869 122/177 (69%)
rpl18NP_001011030.1 Ribosomal_L18 2..175 CDD:375011 115/172 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 189 1.000 Domainoid score I3239
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H756
Inparanoid 1 1.050 191 1.000 Inparanoid score I3753
OMA 1 1.010 - - QHG54131
OrthoDB 1 1.010 - - D1303996at2759
OrthoFinder 1 1.000 - - FOG0002775
OrthoInspector 1 1.000 - - oto104636
Panther 1 1.100 - - LDO PTHR10934
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1864
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.