DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL18 and rpl18

DIOPT Version :9

Sequence 1:NP_001261501.1 Gene:RpL18 / 38794 FlyBaseID:FBgn0035753 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001003432.1 Gene:rpl18 / 445038 ZFINID:ZDB-GENE-040801-165 Length:182 Species:Danio rerio


Alignment Length:181 Identity:122/181 - (67%)
Similarity:142/181 - (78%) Gaps:0/181 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGIDINHKYDRKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKRLFMSKINRPPLSLQR 65
            ||:||.|..||||.|.||||||:||||||||||||.||::..||::||:||||||.|||||:|.|
Zfish     1 MGVDIRHNKDRKVHRKEPKSQDIYLRLLVKLYRFLSRRSDAPFNKVILRRLFMSKTNRPPLALSR 65

  Fly    66 IARFFKAANQPESTIVVVGTVTDDARLLVVPKLTVCALHVTQTARERILKAGGEVLTFDQLALRS 130
            :.|..|...:...|.|||||:|||.|:..:|||.||||.||..||.|||||||:::|||||||.|
Zfish    66 LIRKMKLPGRENLTAVVVGTITDDVRIQNIPKLKVCALKVTDRARSRILKAGGQIMTFDQLALTS 130

  Fly   131 PTGKNTLLLQGRRTARTACKHFGKAPGVPHSHTRPYVRSKGRKFERARGRR 181
            |.|:.|:||.|.|..|...:|||||||.|||||:|||||||||||||||||
Zfish   131 PRGRGTVLLSGPRKGRQVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGRR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL18NP_001261501.1 Ribosomal_L18e 11..188 CDD:299869 116/171 (68%)
rpl18NP_001003432.1 Ribosomal_L18e 1..181 CDD:299869 120/179 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576283
Domainoid 1 1.000 249 1.000 Domainoid score I2086
eggNOG 1 0.900 - - E1_COG1727
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H756
Inparanoid 1 1.050 251 1.000 Inparanoid score I3208
OMA 1 1.010 - - QHG54131
OrthoDB 1 1.010 - - D1303996at2759
OrthoFinder 1 1.000 - - FOG0002775
OrthoInspector 1 1.000 - - oto41702
orthoMCL 1 0.900 - - OOG6_100803
Panther 1 1.100 - - LDO PTHR10934
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1864
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.