DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL18 and rpl1802

DIOPT Version :9

Sequence 1:NP_001261501.1 Gene:RpL18 / 38794 FlyBaseID:FBgn0035753 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001018228.1 Gene:rpl1802 / 3361377 PomBaseID:SPAPB17E12.13 Length:187 Species:Schizosaccharomyces pombe


Alignment Length:189 Identity:118/189 - (62%)
Similarity:145/189 - (76%) Gaps:5/189 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGIDINHKYDRKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKRLFMSKINRPPLSLQR 65
            |||||...:.||.:|::|.|::|||:|||||||||.|||:.:||:.||||||.||.||||:|:.:
pombe     1 MGIDIERHHVRKSQRSKPASENVYLKLLVKLYRFLARRTDSRFNKAILKRLFQSKTNRPPISISK 65

  Fly    66 IARFF--KAANQPESTIVVVGTVTDDARLLVVPKLTVCALHVTQTARERILKAGGEVLTFDQLAL 128
            ||...  |:|:....|.|:|||||||.|||.||||:|.||..|::||.|||||||||||.|||||
pombe    66 IAALTSRKSASLEGKTTVIVGTVTDDERLLTVPKLSVAALRFTKSARARILKAGGEVLTLDQLAL 130

  Fly   129 RSPTGKNTLLLQGRRTARTACKHFGKAPGVPHSHTRPYVRSKGRKFERARGRRSSCGYK 187
            |:|||.||:||:|::.||.|.:|||..   ||.|..|||||:|||||||||||.|..:|
pombe   131 RAPTGSNTVLLRGKKHAREAYRHFGFG---PHKHKAPYVRSEGRKFERARGRRKSRAFK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL18NP_001261501.1 Ribosomal_L18e 11..188 CDD:299869 113/179 (63%)
rpl1802NP_001018228.1 Ribosomal_L18e 10..186 CDD:299869 112/178 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 224 1.000 Domainoid score I533
eggNOG 1 0.900 - - E1_COG1727
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H756
Inparanoid 1 1.050 226 1.000 Inparanoid score I880
OMA 1 1.010 - - QHG54131
OrthoFinder 1 1.000 - - FOG0002775
OrthoInspector 1 1.000 - - otm47341
orthoMCL 1 0.900 - - OOG6_100803
Panther 1 1.100 - - LDO PTHR10934
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1112
SonicParanoid 1 1.000 - - X1864
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.