DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL18 and rpl-18

DIOPT Version :9

Sequence 1:NP_001261501.1 Gene:RpL18 / 38794 FlyBaseID:FBgn0035753 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_502655.1 Gene:rpl-18 / 178342 WormBaseID:WBGene00004430 Length:188 Species:Caenorhabditis elegans


Alignment Length:187 Identity:127/187 - (67%)
Similarity:149/187 - (79%) Gaps:0/187 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGIDINHKYDRKVRRTEPKSQDVYLRLLVKLYRFLQRRTNKKFNRIILKRLFMSKINRPPLSLQR 65
            ||||||||:||..|||.|||::.|||||.|||.||.|||.:|||.|:||||.||:.||.||||.:
 Worm     1 MGIDINHKHDRVARRTAPKSENPYLRLLSKLYAFLARRTGEKFNAIVLKRLRMSRRNRQPLSLAK 65

  Fly    66 IARFFKAANQPESTIVVVGTVTDDARLLVVPKLTVCALHVTQTARERILKAGGEVLTFDQLALRS 130
            :||..:.|.....|:|.:.||||||||..|||::|.|||||:.||.|||.||||::|.|||||:|
 Worm    66 LARAVQKAGNENKTVVTLSTVTDDARLYTVPKISVAALHVTEGARARILAAGGEIITLDQLALKS 130

  Fly   131 PTGKNTLLLQGRRTARTACKHFGKAPGVPHSHTRPYVRSKGRKFERARGRRSSCGYK 187
            |.|:||:.|||.|:||.|.||||.|||||||||:|||||||||||||||||:|..||
 Worm   131 PKGENTVFLQGPRSAREAEKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRASRAYK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL18NP_001261501.1 Ribosomal_L18e 11..188 CDD:299869 118/177 (67%)
rpl-18NP_502655.1 Ribosomal_L18e 20..187 CDD:299869 110/166 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157570
Domainoid 1 1.000 252 1.000 Domainoid score I1143
eggNOG 1 0.900 - - E1_COG1727
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H756
Inparanoid 1 1.050 254 1.000 Inparanoid score I1967
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54131
OrthoDB 1 1.010 - - D1303996at2759
OrthoFinder 1 1.000 - - FOG0002775
OrthoInspector 1 1.000 - - oto17659
orthoMCL 1 0.900 - - OOG6_100803
Panther 1 1.100 - - LDO PTHR10934
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1112
SonicParanoid 1 1.000 - - X1864
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.