DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BHD and LST7

DIOPT Version :9

Sequence 1:NP_648090.1 Gene:BHD / 38793 FlyBaseID:FBgn0261111 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_011571.4 Gene:LST7 / 852948 SGDID:S000003289 Length:242 Species:Saccharomyces cerevisiae


Alignment Length:241 Identity:59/241 - (24%)
Similarity:106/241 - (43%) Gaps:34/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NAVIALCHFCEAHGPCAIFCTQTL-RDTKLEDLSL-EQQTQKTCSACNYSMGKNNNAIYSRDTES 64
            :.||:|.|||:.|||..|..||:. :.|..|:|.: :..|:..|.:|.....:.:........|.
Yeast     3 STVISLAHFCDKHGPRIISVTQSAEKGTLGEELLVPDYPTESYCESCLLQFPEESTRSMRCFIED 67

  Fly    65 GATFVSTKVAVL--PEVASLVKQAAVLSLSNGTDASKDGEFVFFGDSSRGHILSHTFRVSDLQAR 127
             ..|::|:.:.:  ..:.|::|:|    .|..|....:..|:|| |..||..|...|::.|..||
Yeast    68 -VPFITTQYSSIRYQLLNSIIKRA----FSEETMIYDNMPFIFF-DDLRGLNLVIGFKLYDENAR 126

  Fly   128 GYSQLFSIIVLMKDKYFLLNIKPFLAEH--------------LKKVSSELQAAAKKTKETEEQTY 178
            |..:.:..|:.:..:....::| .|:||              :|.:.........||.|...:|.
Yeast   127 GNERRYCFILTVDSRSHDDSMK-MLSEHWNFIIGGFDKMIAYIKNIHKSEFLGKNKTVENNLETL 190

  Fly   179 SER-----QRRLSGAQFLMPTSRALLELTGEEHIFAQLHSHFSWLL 219
            :..     ..|.:.::|    .|.|:.||.::.:|.::|...|:||
Yeast   191 NNNAFIGSYLRANKSKF----GRNLVSLTDDKFLFVRIHKWNSFLL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BHDNP_648090.1 Folliculin 67..221 CDD:288541 40/174 (23%)
Folliculin_C 275..459 CDD:293297
LST7NP_011571.4 Folliculin 70..235 CDD:403032 40/173 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346281
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005615
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106566
Panther 1 1.100 - - LDO PTHR31441
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.