DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14829 and CG17784

DIOPT Version :9

Sequence 1:NP_648089.2 Gene:CG14829 / 38792 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_651254.1 Gene:CG17784 / 42909 FlyBaseID:FBgn0039192 Length:237 Species:Drosophila melanogaster


Alignment Length:178 Identity:56/178 - (31%)
Similarity:81/178 - (45%) Gaps:27/178 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ARQKRHQLIYRNGGTIRLVVG---PVLSTQLEDPVVWRSLVYYYVLHFGAFTLPSAPLYPWDKWE 99
            :|.|| ..||...|.::||..   ||..|..|....|     ::.|. |.:...:.|||.|..|.
  Fly    58 SRSKR-VAIYNGQGVVKLVPSLAYPVKQTDKEQSFWW-----FFNLQ-GQWIPTTIPLYWWSFWN 115

  Fly   100 TI--------YARSLQEKIRSLDETHEDDTRLFVYAALENYMDQVSGSPGRGRHCLLRGICENAQ 156
            |.        :.:.:|.|:.      .|:.|.:||.|:|..|:|:.|:  .|..||||.|||.:|
  Fly   116 TTAFVSTAREWRKDMQAKVL------HDEARTWVYNAIEVGMEQLDGA--YGGVCLLRSICEISQ 172

  Fly   157 -VHHHVGIMAELLVVLLTPGKTRLDVAYKEALAAGQAGIDCLARYSDC 203
             ...:..|.:|::..:|.|....:...|..|..||:.|.||...||||
  Fly   173 KPFQNSNIFSEIVNAVLVPTLDNVASKYLHARDAGRGGADCERTYSDC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 33/88 (38%)
CG17784NP_651254.1 DM4_12 135..227 CDD:214785 33/94 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449131
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116663at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6482
54.950

Return to query results.
Submit another query.