DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14829 and CG14720

DIOPT Version :9

Sequence 1:NP_648089.2 Gene:CG14829 / 38792 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_650108.2 Gene:CG14720 / 41415 FlyBaseID:FBgn0037940 Length:204 Species:Drosophila melanogaster


Alignment Length:153 Identity:41/153 - (26%)
Similarity:69/153 - (45%) Gaps:18/153 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LHF----GAFTLPSAPLYPWDKWE--TIYARSLQEKIRSLDETHEDDTRLFVYAALENYMDQVSG 138
            |||    ..:.|.:....|.:..|  .:|.:.:....|..:..:....|..:|..:|..::.: |
  Fly    53 LHFESVTSGYVLKAEYFLPTNSTEITRVYLKPMAITGREKESPYGALYRWIIYRGIEMVIENM-G 116

  Fly   139 SPGRGRHCLLRGICENA--QVHHHVGIMAELLVVLLTPGKT------RLDVAYKEALAAGQAGID 195
            .|||.  ||||.|||:|  .::|..|::.|::.::|.|..:      ..|..|..:...|:.|.|
  Fly   117 LPGRS--CLLRLICEHAALPLNHESGLLGEIMNIVLRPSSSVDQLGQSSDREYHTSEHFGKRGGD 179

  Fly   196 CLARY-SDCPRGESVLDAYALDV 217
            |.|.| |.|.:....|.:..|:|
  Fly   180 CQAAYASRCKKSPMELISLLLEV 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 30/101 (30%)
CG14720NP_650108.2 DM4_12 96..195 CDD:214785 30/101 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452651
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.