DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14829 and CG13869

DIOPT Version :9

Sequence 1:NP_648089.2 Gene:CG14829 / 38792 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_611458.2 Gene:CG13869 / 37283 FlyBaseID:FBgn0034486 Length:215 Species:Drosophila melanogaster


Alignment Length:228 Identity:70/228 - (30%)
Similarity:105/228 - (46%) Gaps:41/228 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQLVSWIYLLACSLPVVRSAYMLVAAPVGQNITEYMHARQKRHQLIYRNGGTIRLVVGPVLSTQL 65
            |.|::.|.|...:|..|        :.:..|:|.:.|.|:::..|||:|||.|:.|.|.......
  Fly     1 MNLLAKIILFLFTLEAV--------SALEANLTSWRHHRRQKRFLIYQNGGVIKFVSGCAFPAPF 57

  Fly    66 EDPVVWRSLVYYYVLHFGAFTLPSAPLYPWDKWE---------------TIYARSLQEKIRSLDE 115
            .:...||.||:....|: .|..|..|:|.|..|:               ::.||.|         
  Fly    58 MEKKAWRQLVWLMNFHY-QFNEPQTPIYWWKLWDGSRNLKGPLTQPAPPSVPARLL--------- 112

  Fly   116 THEDDTRLFVYAALENYMDQVSGSPGRGRHCLLRGICENAQVHHHVGIMAELLVVLLTPGKTRLD 180
              .|:.:|.::...|.||:|:..:   |..||.|.||||.||..|.|:.|:||..||.|.:| ||
  Fly   113 --VDEPQLLLFKFAEAYMNQLGQN---GSACLDRLICENGQVDEHSGLYAQLLHRLLRPHQT-LD 171

  Fly   181 VAYKEALAAGQAGIDCLARYSDCPRGESVLDAY 213
            |.|.:|...|:.|:||...:.:.  ...:||.|
  Fly   172 VRYLDAYRMGRHGVDCRNAFPEA--HHCILDDY 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 34/92 (37%)
CG13869NP_611458.2 DM4_12 114..204 CDD:214785 37/95 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116663at50557
OrthoFinder 1 1.000 - - FOG0016578
OrthoInspector 1 1.000 - - mtm9573
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.