DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14829 and CG42811

DIOPT Version :9

Sequence 1:NP_648089.2 Gene:CG14829 / 38792 FlyBaseID:FBgn0035751 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001189279.1 Gene:CG42811 / 10178941 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster


Alignment Length:170 Identity:46/170 - (27%)
Similarity:70/170 - (41%) Gaps:32/170 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LSTQLEDPVVW--RSLVYYYVLHFGAFTLPSAP--LYPWDKWETIYARSLQEKI---------RS 112
            :::.|..|||.  |.|.:.:.|... :.||:.|  .|....|...::|..:.::         ..
  Fly    38 ITSSLSVPVVIPDRKLFWDWGLQMN-YALPAEPSSFYAATIWPDEFSRRRKRQLWNETAKYLPEG 101

  Fly   113 LDETHEDD-TRLFVYAALENYMDQVSGSPGRGRHCLLRGICENAQVHHHVGIMAELLVVLLT--- 173
            :...|..| |...:|.:|||.:.|.    |....||||.:||.|: |....:...:|..|||   
  Fly   102 VSTMHPSDFTAGELYESLENMLIQY----GFDESCLLRSVCELAR-HPFKDVENNMLTALLTFTL 161

  Fly   174 ---------PGKTRLDVAYKEALAAGQAGIDCLARYSDCP 204
                     ||:......|:.|...|..|:||...||:||
  Fly   162 TPSLHEAFAPGENVYREVYEHAEQQGFLGMDCGHLYSNCP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14829NP_648089.2 DM4_12 117..210 CDD:214785 33/101 (33%)
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 32/100 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452624
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.