DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14826 and CG34428

DIOPT Version :9

Sequence 1:NP_001097528.2 Gene:CG14826 / 38791 FlyBaseID:FBgn0035750 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001097597.2 Gene:CG34428 / 5740867 FlyBaseID:FBgn0085457 Length:247 Species:Drosophila melanogaster


Alignment Length:260 Identity:68/260 - (26%)
Similarity:98/260 - (37%) Gaps:79/260 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLAVAMLSLPSRGDSSRNLTEFMGHRQKR----WLIYQNSGSLKFSIGPSMPIPLGDKVTFRSCV 68
            ||...|.||.|.         |...|.||    ||||..:...:......:.|||.| :.:.:..
  Fly    13 LLYQVMASLGSL---------FKHQRSKRAPIPWLIYPTTSPTRVMFIGGIGIPLED-LNYEAVT 67

  Fly    69 LSYTLQGGSYSLPTSPIWPWDKWEGTFARSLMQMRRNIERHVANGGV------------------ 115
            ..|.|: ..|.|||:|    |......|..|.|        ||..||                  
  Fly    68 TGYVLK-VEYWLPTTP----DDLRTPTALPLTQ--------VATPGVTGARKQRKPMFENFLVGV 119

  Fly   116 ---------------RYADDARLLVYTALEEYMGRRNNDRSMGRQCLLRSICENAQ--IHHHIGV 163
                           :.....|..||..||   |..:.....||.|:|:||||.|:  .|:..|:
  Fly   120 DELGKNTRKLLTRTNKVLSSYRWTVYKGLE---GLADRLGYQGRICVLKSICEAAEEPFHYTNGL 181

  Fly   164 FSEIMDIVLSPGKA------DLDNDYHDAYAAGRAGANCLGLYSACPRG--------HNFLDGLL 214
            |::::.|:|:|..:      ..||:|:.|...|::||.|..::..|.|.        |:.||.:|
  Fly   182 FADLLHILLTPSSSVDKLSEHADNEYYYAEKMGQSGAGCDRVFKECRRSLLQHFSELHHNLDKIL 246

  Fly   215  214
              Fly   247  246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14826NP_001097528.2 DM4_12 117..210 CDD:214785 32/108 (30%)
CG34428NP_001097597.2 DM4_12 139..234 CDD:214785 31/97 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452645
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.